SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111655 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111655
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily RING/U-box 4.29e-31
Family RING finger domain, C3HC4 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111655   Gene: FBgn0250903   Transcript: FBtr0112743
Sequence length 85
Comment pep:known chromosome:BDGP5:2L:8526605:8528505:-1 gene:FBgn0250903 transcript:FBtr0112743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTIKSWTGVATWRWIANDENCGICRMSFESTCPECALPGDDCPLVWGVCSHCFHMHCI
VKWLNLQPLNKQCPMCRQSWKFNVH
Download sequence
Identical sequences A0A0R1DS52 A0A1W4VWS1 B3N7C8 B4HYP4 B4Q778 Q7KA43
7227.FBpp0079303 7245.FBpp0255882 FBpp0255882 FBpp0079303 FBpp0111655 FBpp0305611 FBpp0194290 NP_001097122.1.81976 NP_001097123.1.81976 NP_001260261.1.81976 NP_001260262.1.81976 XP_001969220.1.56816 XP_002036251.1.34323 XP_015053013.1.41174 XP_016024213.1.80810 XP_016968622.1.21709 XP_016979655.1.97277 XP_017011273.1.47939 XP_017060603.1.74164 XP_017075565.1.81094 FBpp0142607 FBpp0079303 FBpp0111655 FBpp0079303 FBpp0220793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]