SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111700 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111700
Domain Number 1 Region: 1722-1768,1797-2026
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.35e-56
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 468-728,784-904
Classification Level Classification E-value
Superfamily L domain-like 1.22e-42
Family Ngr ectodomain-like 0.027
Further Details:      
 
Domain Number 3 Region: 43-220,274-390
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.16e-33
Family Ankyrin repeat 0.0016
Further Details:      
 
Domain Number 4 Region: 925-947,984-1153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.87e-20
Family G proteins 0.015
Further Details:      
 
Domain Number 5 Region: 2123-2391
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000173
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111700   Gene: FBgn0038816   Transcript: FBtr0112788
Sequence length 2445
Comment pep:known chromosome:BDGP5:3R:16461910:16469856:1 gene:FBgn0038816 transcript:FBtr0112788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPKTGTETALEACDYFVDEVIEASSIRDAREEVRQIKHGELRTAVISGDERTVRVLLA
ALGTERQIIVNMAPSGANTLLFLACQSGYESITQRLLDAGADGRSHAVTKYSPLYAAVHS
GHLGIARLMLDHFPELIQQPTVERWLPLHAACINGHIKLLELLISYSYPDYLYQTYRDEE
GQWEWRLPFDANAHDVTGQTSLYIASILGNKQLVGVLLKWQLHCRRTLGDSASSVSTPIT
PTRKRISFGIQAIMSKLHISGESEGPDDLASQESTECQRCPINVNLLCGAARETALLAAV
RGGHLDVVQSLLQHGANPNIVAKPVEDHNDPKCCEEIYGLSNVPIAEACKQRSLAMLDLL
LKHGARDDNGTAIGMAITCGDEAILSRLLARRVHPDSDYKINKKGLPTPVEVNVFLPSTS
NISYSAMFPNNPTIIDWHSMGSSVQLSVVRVPWMVSGVLLLNPKLQSHPRLNEVALTAIT
RIDFSHNVLTSIPQELFHLVSLRYLNVAQNKITDLPAPIGQTYGCPVLDELFLQDNQLTT
LPAAIFHLPALSILDVSNNKLQQLPFDLWRAPKLRELNVAFNLLRDLPVPPMQTSSSLLS
LDKLNLQSFEEPPSNKPRNVTQQRLTHRNLWSATLDITDNDMKWQHEQDLGDGKTAGVGS
SQLSSLNIANNLFTSIPAALPCLAVNLTRLNMSYNSLRSMGHVTSYPATLKQLDLSHNEI
SCWPSLPRITESDPHLLCYSCVQLPEGRDDDYKTASSKGSSSSATSFRASVLKSVCRHRR
HLRLEALRTLILADNLLTRIQLSTDDATTLFNESEDADWSVVGVNRSKVIFPNLSMLDMT
NNCLKEIPASLHELSSLSVLNISGNVNITELPPHLGLLSRLWNLNTRGCLLQEPLRSMIE
SKKHKTMDIVGYLKSIYEDAQPYARMKLMVVGVAGIGKSTLLDLLRQGAGSGSSSSSHRS
RASENHWAKRMGHARSTSRSHRHSSASSANISTVGVDIGTWICEKRKRAPGSHGPVVFRT
WDFGGQKEYYATHQYFLSKRSLYLVLWRISDGHKGLAELLQWLGNIQARAPNSPVIIVGT
HFDAVGESISPQKAEQLQQLIREKFIAIPDAEKIGLPRVIDSIEISCRTLHNIHLLANII
YDTAMQLRSPGSKEPMLLQKIPASYIALEDIVNVIACNLRAAGRDPVLDGEQYKRLVTEQ
MRLHNYKSFRDAAELQQATTWCHENGVLLHYDDATLRDYYFLDPQWLCDMLAHVVTVREI
NPFAPTGVMKLDDLQMLFRSVQVQGNGNRSYIVSLLNKFEVALTWDSRTLLIPSLLPSQE
AATPNSGSTVKLSQRSRGRSLGCSVSQEVNLNNLIYEQRSAPSSSSSSASVSQGLRRILL
MTYFPSGFWSRLITRILADEQIIEAIRGVYMASQDYADFDLRTSLEQDTQWNLWQTGLAL
YYGPILIFKIWEVPFQKTERTQPFRTDGNRFKLKQDGIWSDVNLSSSSILEVYFPLYEVN
ISQEVDDNERQLLAEIRPHMSQVAKLLALTVDHIDLLLEDWYPSLGTRFVHTSEGRFLIT
RLVLCPRCLWKLQLQQNNEPSDREVPPVGCNRPSRSSRRGAGAYFLHGVGDPGEDGALNV
FSAYLNATARRERRSEDSLGAGSDADSGVGPDSAGSSRNTSVDGHPGYHLPDNSNVCYAW
MIEECILSVYNQSKISCPVHLEQSMAQLAPDVIFADIPDKHTIPSECIIKGSLLGRGAFG
FVFKANCKVRGARSFKPVAMKMLQPVPPGARAKESALMAFKVAVGKWDRDPLQHSCKAYC
TARQELAVLLTLKHPNIVPLVGICIKPLALVLELAPLGGLDALLRHYRRSGAHMGPHTFQ
TLVLQAARAIEYLHRRRIIYRDLKSENVLVWELPQPHTEDSPRNLVHIKIADYGISRQTA
PSGAKGFGGTEGFMAPEIIRYNGEEEYTEKVDCFSFGMFIYENISLRQPFEGHESIKECI
LEGSRPALTQRETQFPTCCLDLMVLCWHEQPRRRPTASQIVSILSAPECIHLLDVVAMPH
SEKIVCGVFQSLVGMGDDERCGLELWLPSFGSRIDILDCSPSGSLLQCNSISCSPQPQVA
PPKTPENGANSRARSAQRLPKMNMLCCCLVGEAIWMGDVSGNLHAYSTSTYAHLFSYMLD
PNIKSAVISLVYMEKIARVAVGTHNGRVFLVDATQMPSNCAFAEGSFVLTEICSGFVLHA
ACSVVVDGIYELWCGEIAGKINVFPLNENGVSGHQALCHSEEPNLIEDVKVARMCSNESH
VFSCLYPGCMVYQWDVISKRIENKLDCSKLLPCSESLQSIAIDEHVNLIKCQISALAAHN
SELYIGTTWGCLIVAELHTLRPISVFRPYENEIKSIITLSKDNVPLIATIGRRYRSLISR
YVDSAESSTKSSAVSTPTHGAAKSVPPADVDNHIHCLLWRAKHWT
Download sequence
Identical sequences Q9VDJ9
FBpp0111700 7227.FBpp0111700 NP_001097847.1.81976 FBpp0111700 FBpp0111700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]