SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111718 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111718
Domain Number 1 Region: 105-173
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.03e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 480-549
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 222-291
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000499
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 533-596
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000931
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 421-485
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000236
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 157-221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 7 Region: 45-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 8 Region: 376-431
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 280-348
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 10 Region: 3-53
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000101
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111718   Gene: FBgn0001083   Transcript: FBtr0112806
Sequence length 755
Comment pep:known chromosome:BDGP5:X:11886948:11892533:-1 gene:FBgn0001083 transcript:FBtr0112806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKFTLGEKIQYTCPKGHSLLGQTERECRLDGTWSGSSPTCKYVDCGSLPELKFGSIHM
SEERTSFGVVATYSCHENYTLIGNENRTCAMDGWSGKQPECLVDWCPDPQPIAGGDVRFN
DKRAGSTATYVCEPGYVLVGEAIISCGLGGEWSSKTPSCRFVDCGAPARPNRGIAILLNG
TTTVNSVVKYECDEDHWLDGQSELYCTREGKWSGEAPVCELVTCETPSVPSGSFVIGYDY
NVHSKIQYNCDPGHIMHGTPVLECLDSGEWSADAPYCEYIDCGTILPIPYGSHKYVTNTT
YVGSEVVFSCSQSHKLSGVLKRTCLESAVWSDASPKCEEIRCPEPKLAAHSLLSVTGNDR
MYGRTLIRTSESSQNTAQTYKIGALAKYRCERGYKMVGEALATCTDSGQWSGTIPECVYV
ECGAPEGINNGKVVLATNATYYGAAVLYECNVNFKLNGVSRRLCTEHGNWSHEAPECVEV
VCDTPNINENLIVEAGPRAVGSVATFKCAKGRIMMGNDTRVCQKNGKWTGKSPTCRPVDC
GRPLAIENGRVIVVNDSTLYGGSAEYHCIPNYNRIGQYLRKCTEDGAWSGKQPRCELATA
EGQETSELGTGVGIGATVIVALLVIFGLIFLYRNKARPVKNTENVQAAETKDERNAAVMS
YSTLEANNRMHMDNNPSATFNTFHGGAGGRSNGGGNPDANSNGERLNNNRSENIYDQIPN
EQFYDAPYEMRTNDEVYEPEPVASNVITINGISVR
Download sequence
Identical sequences A8JUT1
FBpp0111718 FBpp0111718 NP_001096961.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]