SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111850 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111850
Domain Number 1 Region: 77-361
Classification Level Classification E-value
Superfamily L domain-like 1.09e-58
Family Ngr ectodomain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111850   Gene: FBgn0028487   Transcript: FBtr0112937
Sequence length 522
Comment pep:known chromosome:BDGP5:3R:9520979:9526509:-1 gene:FBgn0028487 transcript:FBtr0112937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGPYPRRRRYYQIREFQMASSADELESEDPDDELELDDSEPPTRAEDLPKRLYDINEAD
ADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQSLTVLTLHDNALVE
LPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELNPDISDLHMLEFL
DGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDLMHNDLTSLPEDM
GLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSNLPHLKILDLRDN
KITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPIKTIRRDILQCGT
TRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQMDDGDIPGNFPDSFHHQQQQ
NGFQCPCSYPCQQQQMQQQFCVYEPLRNCQEYDRQTQGRIYEPENYQQQHQNGSLRSLFV
QQQQQRMEYPYPGYFMYQQQQQQQFSYEQDPSSRSAVHPRWV
Download sequence
Identical sequences Q6NLJ7
NP_001097772.1.81976 NP_001262547.1.81976 FBpp0111850 FBpp0111850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]