SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111851 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111851
Domain Number 1 Region: 30-313
Classification Level Classification E-value
Superfamily L domain-like 6.8e-59
Family Ngr ectodomain-like 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111851   Gene: FBgn0028487   Transcript: FBtr0112938
Sequence length 474
Comment pep:known chromosome:BDGP5:3R:9520979:9526536:-1 gene:FBgn0028487 transcript:FBtr0112938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKRLYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQSL
TVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVELN
PDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKIDL
MHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCSN
LPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNPI
KTIRRDILQCGTTRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQMDDGDIPG
NFPDSFHHQQQQNGFQCPCSYPCQQQQMQQQFCVYEPLRNCQEYDRQTQGRIYEPENYQQ
QHQNGSLRSLFVQQQQQRMEYPYPGYFMYQQQQQQQFSYEQDPSSRSAVHPRWV
Download sequence
Identical sequences A8JQZ8
NP_001097773.1.81976 FBpp0111851 FBpp0111851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]