SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0111979 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0111979
Domain Number 1 Region: 3015-3129
Classification Level Classification E-value
Superfamily Bromodomain 7.72e-35
Family Bromodomain 0.00016
Further Details:      
 
Domain Number 2 Region: 2628-2689
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000000244
Family PHD domain 0.0027
Further Details:      
 
Domain Number 3 Region: 2691-2748
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000062
Family PHD domain 0.0052
Further Details:      
 
Domain Number 4 Region: 950-1025
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000163
Family Methyl-CpG-binding domain, MBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0111979   Gene: FBgn0033636   Transcript: FBtr0113066
Sequence length 3131
Comment pep:known chromosome:BDGP5:2R:7466385:7503550:-1 gene:FBgn0033636 transcript:FBtr0113066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNAGDGSDGKNSNKNSNAGGGGGAGGPHDPTGLLDAASLFAYWGRDPTGAAAAAASNP
LFNSQFNAAAAAGLGLLPQAGGASANDRYSMAAAAAAAAGAHHHQNTMAVAASQAASLAG
LHPASWWSMAQLAAQDYFSRLQASGLSPFPHPDLAAAFGPAGMGMGGGAGGAGAGGGGAG
VLGQGGGGNGGSGNGGGGSSSGSSGSKSNKSRKEKRAAQQQQQQQQNLANSLNAAAAAAA
AAAANNPAAALASMHGFGVGVPGTSIPSVSTGSGSISTNSGGHGSYKSTASAYGKPSTMT
SSSMANNPGSAYDPVTLHKELLAMQAVAAAASGSGSSGSSGKKSGGGGSSSSSMHSLGMG
IGGSGGMMSSGKASTSVSASNSSLGGMHPSLTSSNPLMSPHAGMGSSSSSSSKDRDKNNP
SLNALNSLSQFGALGMTPQQSMQAAMNAFAASTGVSPSATVTSSPHHSSQQQQQMGGNSS
TSGSGKSSSKDYMMGTGSEHPSLLGVRLPPDTEIIKYTSSIVGPKIPGTTSRGRKKTISE
TEQQTTQQQQKQQHQAEQHLLQQQQQAQKELDSTKNAISSLLAFPGLSPAKRARLEMEYA
AMAAAAQQQHQQAQQQHQAQQQLHGMLGAAGIPGMAGLVGLPGMSGNPLDQLSVSKASSS
TAPTTSTSSSSAGSNLLNQSNSDRVEVIKLPPTITSNGAYNLSSKGKEVHDLTTDMATNS
GGVNLSLKSNAGSSALTPSGAVGSASNPITIDDFDAPLNLSMKPSDKSNSSSSNAAAGGS
SSSSAALANLASDYQAASSGQSGNSLQSLSSITAALGGTGGMPGGSISGSGGTSPAPAGA
GSGATGGGSGSGGSGGGSSSYKEGRPRNLGRGVSKPKKNTVASLLAQSRAVGLKPMLATQ
QLLQQGADIEKIRLALSEANAHMETSTDSESVAAESGLSESESEDANILNVAELRVPLEL
GWKRETVIRGLTKQGQIRGEVTYYAPGSTTPLKSNGQVFAILEQQPSNLSRENFSFSARA
IVGSFLQPAPPPYANDGEYIRMTDEDVAKRLEDLKVFTRQTLNVEQRIEIAKQQQAMRDA
KKLQKEELARNKEKARQEKNSKLEQQRKDKELKNQQAVEERKKRQEELDRLKQEELLKKQ
QEKEKRRQEAILAKEQELQKQKEMLLAAEMERERRRQHMSLIRMLELRRKFEDREKKKHQ
LVLDRLLLRERRMAERKRDAEILQLIRRPNEDSEMPQELVIPELDRIAGNRLPGQAMADL
LMVFEFLHNFGETLGFDMESLPSLQNLHDALMSDSNADAEEELLSVMTHLLVCAIEDPGV
PNPGRHTTLLGQSLRNADITNSNVSEILRIYLYATATGEVRQMHGITVDRERERRVPDHH
QLDSDTTTHSHSVKNQEYYKLLHENDTWKLSQSLKDRPFVALNPTRKAQMLAHLCNDLLM
NKAVLRQIDGSLETCAQMRKEKYMTDMKVRKYKALHMRKARIEAYERAQAEREAAMQALM
AQQKLDAERLKAEEEAKAAAAEEAAAAAGTDGEATKGGSPNGEKPEDGDQNEEGAAKEPQ
QQQQQPMEVDGVVDEASLVSPAKTIIQTDNSLTPSKQDMPTPTYQINGSSTPTTSGVTGG
DMNVLLQAKKSGARNSINDEHHHDVSIIDDDLSDLDSEITNVEEDEDNRLSADELQKKLD
KIVRASLNCKEALEKSTNQLRAACFGQDRFWRRYWKLPKAGGIFIEALESAQNDICDYHE
ALEAMDDKKDANDEKENSENEKDVAAESSEQPMEVDESITKLEDGVPASDVGMPESNQQN
AHQDEEDDDDDVTEINKVEPEIVDLGDDDDDAAPPLPKIEPPRPEIKVKSEMELMGPPPT
TMISTKTDFEAEIKIPSMPGILMPPTLNNNNTNNNNNNNGSDNCDKLETGLGLGQQQQNF
SQSVIKTEDVKKEDDCIIVSTSSVDDTPKWFSIVRREVPLISELPAEEGGVVGQELQISY
ANQNCSAQLQLQGHPWDLINNMQYYSIPMDECKVDTSKLGNECIFSLSGLDEKQMLAKVE
EYKAHKVESKNGLGSPHRHHETKDDEEQAKLKLDKEIDTEMETDADDLAGKEKFFRLRSD
VPPDTGGGVSEGTDVKPKIELRLDEALSQAYYHNIANMSLSSVQTYIPIDIPLPLSMTPD
EHRLLEQVKLAGFPERVHGVYVPRRQRYGWWQLDDEQKLRQLLKTLNPSGLRERELQENL
QRFLGLEQPLGVNYKLKSDIDFPEEFLMPDKKGDWNPKVAKRVELALIEQLESLEDKVAS
ASMQLKNWQLPNRVESELTLDSQEDVTEEDFVSIIPMIRERIIDLEANIERRYLKPPLGS
QTGDAHLAVIAQNQHTTTQTQNSASAAAYLLQMQQQQQQQQLAQQQQQQQQGSGAGNSLN
PSSFNERTMALAAAAAASGPGNATGVANSAVVAGATPCESGSGEPNSGNASPASNCDSDR
DEKVEQIPKGLVQWRDAVSRSHTTAQLAMALYVLESCVAWDKSIMKAYATKNKSSKKKSS
AKKQATPSKKQQQKKNKKEQQLTPNGKESKSKSAINKPENQAPLSIKINLKALAQNGQCL
LKTKTPPILTKSPTASPSSHPNTSDSDSDFGKRTKKKSGGKRRRSANNTNSSKYSNSLQN
CQFCTSGENEDKLLLCDGCDKGYHTYCFKPKMDNIPDGDWYCYECVNKATNERKCIVCGG
HRPSPVGKMIYCDLCPRAYHADCYIPPLLKVPRGKWYCHGCISRAPPPKKRSAGGTSGSS
SKSRRDRDRESGGSAKRRSDNSKTPAMEHMQQQQMPLAGGDSHHHHHQQPPSLNSSHDES
MNSLPAAPLSPAHSVVSATNYDDQHHANNSVDGSSRFHAHLIPPSNNGTAALLEDVPGGA
NVMPGVYPVYTPVAAGNFSAGLINQAPVQPAMPFANVVAMSPRAVTPTRTRTPTPTPAPT
PPPPPPTPLLMQASPTATALHVNACQSPPQQQHAQLMTMPSPPAIGVGTATNQMSPPPIN
IHAIQEAKEKLKQEKKEKHATKKLMKELAVCKTLLGEMELHEDSWPFLLPVNTKQFPTYR
KIIKTPMDLSTIKKKLQDLSYKTREDFCVDVRQIFDNCEMFNEDDSPVGKAGHGMRKFFE
SRWGELTDKHS
Download sequence
Identical sequences A8DYA3
FBpp0111979 FBpp0111979 FBpp0087196 NP_001097270.1.81976 7227.FBpp0111979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]