SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112004 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112004
Domain Number 1 Region: 10-148
Classification Level Classification E-value
Superfamily L domain-like 1.07e-28
Family Internalin LRR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112004   Gene: FBgn0034282   Transcript: FBtr0113091
Sequence length 363
Comment pep:known chromosome:BDGP5:2R:13754562:13759515:-1 gene:FBgn0034282 transcript:FBtr0113091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKRIELERRARKVNQITELNLDNCRSTSIVGLTDEYTALESLSLINVGLTTLKGFPKLP
NLKKLELSDNRISSGLNYLTTSPKLQYLNLSGNKIKDLETLKPLEEFKNLVVLDLFNNDA
TQVDNYREKIFKMLPSLNFLDGFDCNDEEVQSDGDDDDEVNGNDSDEVGDKCNAFCLNGL
EIDLDELEAFEKRVKAKKSLQDKPPPQSEDKEVDELDEYLKELQLRESTDASTDEQSVIN
ATPQPPSNSNLSFVILLYWFLAILNLGSATYFSDEDDDSDDSDEEANGEVSLSEVYNDDL
EEDNSDWEGEDEAGEEDEEEDSDIDDADGDANESAASVNAKDKDGEKEADESQVRGKKRK
HDG
Download sequence
Identical sequences E1JGK5
FBpp0086002 7227.FBpp0112004 FBpp0112004 FBpp0289639 FBpp0112004 FBpp0289639 NP_001097361.1.81976 NP_001163184.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]