SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112010 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112010
Domain Number 1 Region: 22-268
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 9.07e-66
Family BAR domain 0.00063
Further Details:      
 
Weak hits

Sequence:  FBpp0112010
Domain Number - Region: 337-372
Classification Level Classification E-value
Superfamily SH3-domain 0.0538
Family SH3-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112010   Gene: FBgn0034433   Transcript: FBtr0113097
Sequence length 378
Comment pep:known chromosome:BDGP5:2R:15194952:15198197:-1 gene:FBgn0034433 transcript:FBtr0113097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSKDGISPEAVLEQAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRH
LHAFIQTQVRYYKQCGDVMEQLQRELAKMQHPKPRLRINSEDVDCGPPSSVSMHSCDSDS
LGGIALDSDPDPDLDKSLTNLLEDFHIEFDTTAVSTVIFVTECSPVNEDYMYGKQGLLKG
LVPRAFVEMLDEEHDVTL
Download sequence
Identical sequences A0A0J9RGK6 A8DYJ1
FBpp0112010 FBpp0112010 NP_001097375.1.81976 XP_016028564.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]