SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112011 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112011
Domain Number 1 Region: 22-256
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-65
Family BAR domain 0.00051
Further Details:      
 
Weak hits

Sequence:  FBpp0112011
Domain Number - Region: 325-360
Classification Level Classification E-value
Superfamily SH3-domain 0.0519
Family SH3-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112011   Gene: FBgn0034433   Transcript: FBtr0113098
Sequence length 366
Comment pep:known chromosome:BDGP5:2R:15194952:15198197:-1 gene:FBgn0034433 transcript:FBtr0113098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNINLPNFNVKNLVKEAGSTISRVVQLTEEKLGTTERTEYDLHFQNLAERADVTKTWTEK
IVRDTESVLIPNPQNRVEDFIFEKIEKSKPKRLSNLEHLALDMIEAGGDFGQDLPYGQAL
IKVGQAEQKLGQCEHDFIATSGICFTQPLRKFLDGEMKTIGKERGILETKRLDLDACKNR
VKKARSMLGQQSAERDLRVAQAEFDRQAEITKLLLDGISTSQASHLRHLHAFIQTQVRYY
KQCGDVMEQLQRELAKMQHPKPRLRINSEDVDCGPPSSVSMHSCDSDSLGGIALDSDPDP
DLDKSLTNLLEDFHIEFDTTAVSTVIFVTECSPVNEDYMYGKQGLLKGLVPRAFVEMLDE
EHDVTL
Download sequence
Identical sequences A0A0J9RHT5 A8DYJ0
NP_001097376.1.81976 XP_016028562.1.80810 FBpp0112011 FBpp0112011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]