SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112019 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112019
Domain Number 1 Region: 798-864
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000629
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 715-784
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000341
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 
Weak hits

Sequence:  FBpp0112019
Domain Number - Region: 878-917
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000486
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112019   Gene: FBgn0034720   Transcript: FBtr0113106
Sequence length 1152
Comment pep:known chromosome:BDGP5:2R:18221009:18233662:-1 gene:FBgn0034720 transcript:FBtr0113106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQINGLAAGPTMAASEPPEPPPRNPDRINASLHKLGESKIAKSLDTSVSTGLKEKAASVN
NNKPIRPLLSLDSSVTASTSSGATGSGGGGAPAKPSPLVLASKRDLTPSNESSSSPSSSN
GSNQTLTPPMTADNQPLQQQLQHHQHRSPAYPGKPAEAAGGVPQQQQQQQQLPNGIGSSH
CNSNSNGISSTCNSGTAMIHANNSNLIAAGHLAQAAGPAHNAPSSGSALNAVDKRNANLS
EPDQDLPPNLNVNLSPNPSLALGAPHSPTSAASAALLLLESCDGNRNDESRFHHLHSAPR
PEATMKLREENDRLNAELLRLRRLLELSTDGAVGGVDTAPEMEAVASGEGSAAKERIERL
ESELRSVKNQLLTMRLERKKLRTDKSDLLGQVKQLCASLQEKEQELRDFIRNYQERVRET
ETTNAKISGDRDRERFQLLKQARDEAERSLALAQQLSARDLQLQRLQEQLQEARRQLTGC
LSDQESLHSFAPLTPPSAASGMLSQMAAASGMGGGLAGMRGTTEDSGRGNSLSAFSGSLS
GGSGATAGDRNSCSNDSGLRNSSDRESTGGELNFSDGTCDNGPCITVDPDSISLVSSQNM
YQFGTPKERSPTLSPLNSAAYSRSVEQLGSPVDPEGPGNGAISRKFANASKSGPLGARNG
RGGTWGSISRVFARSRNKNKALSADGVTEYADYSWNPLTEEGYAEKLRLLREASQLPIDR
WRATQVLAWLEVALGMPQYSARCAENVKSGKVLLELNDVELEAGLGLAHPMHRKKLRLAI
EEQRRPEMVRYPLITQLGHTWVATEWLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKF
LGVTRKFHQASIVHGIHVLRIVKYDRQTLAMRRVQSETVDTDPIVWTNQRFIRWVRSIDL
GEYADNLKDSGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALILPARATL
GQGIRSGCGVVPLTGPGGLQHYATTDRRSSGNLRISAWKGSQSSLSKAFRFNSKPHRTGD
RSSFGNSTSPTPSYSSSEGGGGIYATIGHQYPNPHTNLQQQHYHHFLPPPTTAPPPIPSA
GGIYSHGPPPGHRVSAPPVGGALDAVSTDPQMLYEQSRRRVKSISDIGASTSAGSVGACS
LGGISASSESPE
Download sequence
Identical sequences A8DYM0
FBpp0112019 7227.FBpp0112019 NP_001097414.1.81976 FBpp0071757 FBpp0112019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]