SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112020 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112020
Domain Number 1 Region: 669-735
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000434
Family SAM (sterile alpha motif) domain 0.024
Further Details:      
 
Domain Number 2 Region: 586-655
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000236
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 
Weak hits

Sequence:  FBpp0112020
Domain Number - Region: 748-789
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000329
Family SAM (sterile alpha motif) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112020   Gene: FBgn0034720   Transcript: FBtr0113107
Sequence length 852
Comment pep:known chromosome:BDGP5:2R:18225089:18260610:-1 gene:FBgn0034720 transcript:FBtr0113107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADNQPLQQQLQHHQHRSPAYPGKPAEAAGGVPQQQQQQQQLPNGIGSSHCNSNSNGIS
STCNSGTAMIHANNSNLIAAGHLAQAAGPAHNAPSSGSALNAVDKRNANLSEPDQDLPPN
LNVNLSPNPSLALGAPHSPTSAASAALLLLESCDGNRNDESRFHHLHSAPRPEATMKLRE
ENDRLNAELLRLRRLLELSTDGAVGGVDTAPEMEAVASGEGSAAKERIERLESELRSVKN
QLLTMRLERKKLRTDKSDLLGQVKQLCASLQEKEQELRDFIRNYQERVRETETTNAKISG
DRDRERFQLLKQARDEAERSLALAQQLSARDLQLQRLQEQLQEARRQLTGCLSDQESLHS
FAPLTPPSAASGMLSQMAAASGMGGGLAGMRGTTEDSGRGNSLSAFSGSLSGGSGATAGD
RNSCSNDSGLRNSSDRESTGGELNFSDGTCDNGPCITVDPDSISLVSSQNMYQFGTPKER
SPTLSPLNSAAYSRSVEQLGSPVDPEGPGNGAISRKFANASKSGPLGARNGRGGTWGSIS
RVFARSRNKNKALSADGVTEYADYSWNPLTEEGYAEKLRLLREASQLPIDRWRATQVLAW
LEVALGMPQYSARCAENVKSGKVLLELNDVELEAGLGLAHPMHRKKLRLAIEEQRRPEMV
RYPLITQLGHTWVATEWLPDIGLPQYAEPFVQSLVDARMLDTLSKKELEKFLGVTRKFHQ
ASIVHGIHVLRIVKYDRQTLAMRRVQSETVDTDPIVWTNQRFIRWVRSIDLGEYADNLKD
SGVHGGLVVLEPSFSGDTMATALGIPPSKNIIRRHLNTEFDALILPARYLIYCQMEEFQM
EASRQLAKLQGH
Download sequence
Identical sequences A8DYM1
FBpp0112020 NP_001097415.1.81976 FBpp0112020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]