SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112051 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112051
Domain Number 1 Region: 65-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-71
Family FCH domain 0.00000047
Further Details:      
 
Domain Number 2 Region: 600-661
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000354
Family SH3-domain 0.002
Further Details:      
 
Domain Number 3 Region: 409-480
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000103
Family HR1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112051   Gene: FBgn0035533   Transcript: FBtr0113138
Sequence length 665
Comment pep:known chromosome:BDGP5:3L:4323530:4363974:-1 gene:FBgn0035533 transcript:FBtr0113138 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKKLAQITKKKTVADLEAECVHSAIAFTCVRVCAKLLASGSSRSSSNNKLAESENSAQ
NSNNMSWGTELWDQNENLAIHTNRGIDALDKFANFLRDRVAIETEYAGKLRRLVKNYQPK
KKEEEDNEFTSVQAFRNLLKEVGDLAGQREVVSESLQLQIIAGVTLLSKTLREERKKCLS
DGATLQQNLTTQLSSLDRAKRNYEKAYRDSEKAVDSYKRADMDLNLSRAEVERYKNVMTS
KIQQSDDAKNEYANQLQKTNNLQQQHYSMLLPSVLNRLQELDEKRTRGFREFIVGAADVE
SSVAPIIARCMEGIVKAGESINEKEDTFKVIERYQSGFTPPRDIPFEDLSKCDPDSVQDS
HYSNSTSNHLTIRGTMSANKLKKRVGIFNIFGSNKNSLTADGQKEDFSDLPPNQRRKKLQ
AKIAELTQNIAQETKARDGLMKMKIVYEANSSLGNPMTVEGQLNESEHKLEKLKVDLKKY
QGFLEKASQVPTATSSPQASRNQLQNGHRTSRHSNGSADDHHDDGDDQPDDAGSLSRSDS
EDNVAQIQNGHNNNNNGSASPESGLGTSHTSLPGSGQGSANENAIGEDTYYETEVETLNP
VGKCRALYPFEASSEGSIPMSEGEELQVIEIDQGDGWTRVRRENNSNGWDEGFVPTSYIE
ITLYA
Download sequence
Identical sequences A8JNK4
FBpp0073195 FBpp0112051 FBpp0112051 7227.FBpp0112051 NP_001097501.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]