SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112119 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112119
Domain Number 1 Region: 4-263
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.88e-47
Family FCH domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112119   Gene: FBgn0037702   Transcript: FBtr0113207
Sequence length 1220
Comment pep:known chromosome:BDGP5:3R:5343169:5352964:1 gene:FBgn0037702 transcript:FBtr0113207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG
TLNSTFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTL
ECVQAIQTSTVAVQKLRDLYASKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKALLDK
HNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFV
DMSVDKLLEQFVLNKYTGLEKPEMPELEYVALSSGSRLQQPQVSASASNSNSATSIQAAL
RAGNAATTASGSAVSMDQRGDALAAISLGSGSAASGSIPFAEDPILGAMGSPRPTSPDML
AGANASGIQSQPTGGATSTVKSLRSWFLPTAKQQPSAGAGNFGMAGSGSTNNTTTTTTAS
NNSNNLNTNNTTATTTTTTGTNNLTTNITKNSPNSEDTSNQDQTQQQPAEALTPTASATA
IAAASAPGKKQLNATTSEQQLSKSLNEQEHLQQTAAATAATTAAATTATTTTSRRATSLL
NIFTSNSQVSGILRSRRDKTKTKKAKKKKDNEAAENIQEERLTSLDRGNNTLLDYDDHGR
SMKTQNSSGSSAGGGLAALSVTSAQGSVDSAGASSMGGSGGAAVASGSLPNAGALTNSAS
ITAPGAASGTGTGYEVDEEGFSIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHV
SIKPLKNGQAPMSASVDELRATVENISLSPTGVFSHHSQQLQAARGAPASRQQSPEISNA
STPTASVHPYAPLQSPTLSNNNNANNTTNSRYADLGDIFSELGDMSMSAPSSATLGKPPG
RQIPTPTSASTGGSIAIPRPPSRRSDMIAIGPAATGTAPGRGRMSPAPVTAMNRAESIGS
LEFRTAIGGVGSSRGPSPLTIGISDTIPLAVAFHEIIHAYFRGSDESRCQVKVSGDMMLS
FPAGIAGLLANNPNPAKLGFRIKHVQNLENLVPNGKLVQIDRQQSSSVSTMLEFNMGALT
ALLRRQAENNPTASYFNVDILKYQVRTKPGASSCPFQLVSYWKCESSYTALKVDYKYNNH
AMASASPLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRA
RLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCEGDGIRS
GATPTPPSVGSTSPYSAKSN
Download sequence
Identical sequences Q6AWD5
FBpp0112119 NP_001097723.1.81976 NP_001097724.2.81976 FBpp0112119 FBpp0081543 7227.FBpp0112119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]