SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112120 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112120
Domain Number 1 Region: 4-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-42
Family FCH domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112120   Gene: FBgn0037702   Transcript: FBtr0113208
Sequence length 1199
Comment pep:known chromosome:BDGP5:3R:5341758:5352959:1 gene:FBgn0037702 transcript:FBtr0113208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAG
TLNSTFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTL
DKVQELEKLRKDNGSHKDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQE
IEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEK
PEMPELEYVALSSGSRLQQPQVSASASNSNSATSIQAALRAGNAATTASGSAVSMDQRGD
ALAAISLGSGSAASGSIPFAEDPILGAMGSPRPTSPDMLAGANASGIQSQPTGGATSTVK
SLRSWFLPTAKQQPSAGAGNFGMAGSGSTNNTTTTTTASNNSNNLNTNNTTATTTTTTGT
NNLTTNITKNSPNSEDTSNQDQTQQQPAEALTPTASATAIAAASAPGKKQLNATTSEQQL
SKSLNEQEHLQQTAAATAATTAAATTATTTTSRRATSLLNIFTSNSQVSGILRSRRDKTK
TKKAKKKKDNEAAENIQEERLTSLDRGNNTLLDYDDHGRSMKTQNSSGSSAGGGLAALSV
TSAQGSVDSAGASSMGGSGGAAVASGSLPNAGALTNSASITAPGAASGTGTGYEVDEEGF
SIQPAKEIAWEEGQDKSGSFYSDSDTDSDNDKQERRIHVSIKPLKNGQAPMSASVDELRA
TVENISLSPTGVFSHHSQQLQAARGAPASRQQSPEISNASTPTASVHPYAPLQSPTLSNN
NNANNTTNSRYADLGDIFSELGDMSMSAPSSATLGKPPGRQIPTPTSASTGGSIAIPRPP
SRRSDMIAIGPAATGTAPGRGRMSPAPVTAMNRAESIGSLEFRTAIGGVGSSRGPSPLTI
GISDTIPLAVAFHEIIHAYFRGSDESRCQVKVSGDMMLSFPAGIAGLLANNPNPAKLGFR
IKHVQNLENLVPNGKLVQIDRQQSSSVSTMLEFNMGALTALLRRQAENNPTASYFNVDIL
KYQVRTKPGASSCPFQLVSYWKCESSYTALKVDYKYNNHAMASASPLLNVTLSVPVNGSV
RNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCE
GTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCEGDGIRSGATPTPPSVGSTSPYSAKSN
Download sequence
Identical sequences FBpp0112120 FBpp0112120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]