SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112127 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112127
Domain Number 1 Region: 5-39,66-283
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.3e-64
Family PhyH-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112127   Gene: FBgn0037819   Transcript: FBtr0113215
Sequence length 288
Comment pep:known chromosome:BDGP5:3R:6503585:6506499:-1 gene:FBgn0037819 transcript:FBtr0113215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSKLLDELNENGYIVIEDFLTAEEVDSLYQAGRALCLDAPQNNRKIFSTIKQEDAQGKE
LYFMESGDKVRYFFEKGAVGDEGQLLVDPMIALNKVGHALHVEHPAFNAITFSNRVREIC
WQLNYNKPAVCQSMYIYKNPGVGGEVTPHQDSWFLHTDPNSAVGFWLALEDCTLQNGCLQ
FIKGSHKSGVHRRYLRNPDKDASELMVYDRAAPIYPQSSFTPMQVSKGTCILIHGNVVHK
SEPNRSQKSRHAYTFHVIETENNVKYSEDNWLQAPKDKPFPVLFERKA
Download sequence
Identical sequences Q9VGY8
NP_001097740.1.81976 FBpp0112127 FBpp0112127 FBpp0112127 7227.FBpp0112127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]