SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112155 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112155
Domain Number 1 Region: 83-243
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.81e-17
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112155   Gene: FBgn0038510   Transcript: FBtr0113243
Sequence length 248
Comment pep:known chromosome:BDGP5:3R:13264690:13266450:-1 gene:FBgn0038510 transcript:FBtr0113243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEGKLEQTRSKLEQILNIHKPNYLDSTFQELLPNFCKGFLFSEKWVKWIKIVLLGTLIL
LGVKYYYEEMQGKLFNYWYFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPEDRVE
LKPGEQPWYFGWSNCHAETAEEFRRHYGRPYFLPEGSENNAVDWFFIGLSGLGAQMHIDN
VRLPSWQAQLAGSKRWLLVPPPECYLQCRRFDVVVQQGDIIVLDTNKWYHQTFVQPGAIS
LTIGAEYD
Download sequence
Identical sequences FBpp0112155 FBpp0112155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]