SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112156 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112156
Domain Number 1 Region: 84-307
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.81e-27
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112156   Gene: FBgn0038510   Transcript: FBtr0113244
Sequence length 312
Comment pep:known chromosome:BDGP5:3R:13264690:13266450:-1 gene:FBgn0038510 transcript:FBtr0113244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEGKLEQTRSKLEQILNIHKPNYLDSTFQELLPNFCKGFLFSEKWVKWIKIVLLGTLIL
LGVKYYYEEMQGKNCALYLPRNLRYAFRPPENCNFCANIKNVPRLKNISPQEFEKKFAYS
AAPVIISDATKNWTAVSLFNYWYFRDVYTKAKQKQHIRECQFLPYKTGFLDIYDALDMPE
DRVELKPGEQPWYFGWSNCHAETAEEFRRHYGRPYFLPEGSENNAVDWFFIGLSGLGAQM
HIDNVRLPSWQAQLAGSKRWLLVPPPECYLQCRRFDVVVQQGDIIVLDTNKWYHQTFVQP
GAISLTIGAEYD
Download sequence
Identical sequences A8JR34
FBpp0112155 FBpp0112156 FBpp0112156 NP_001097824.1.81976 7227.FBpp0112156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]