SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112237 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112237
Domain Number 1 Region: 18-70
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000271
Family ZZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112237   Gene: FBgn0040355   Transcript: FBtr0113325
Sequence length 221
Comment pep:known chromosome:BDGP5:X:2784801:2787997:1 gene:FBgn0040355 transcript:FBtr0113325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSPSMPRRRQIGHTSGHCNVRCDGCGNNRMTFYRYKCLHCLDYDLCSDCKENGVSNGL
HSLDHPLQCLMDRDALELHFAGEPIPILCADSFTCPVCGEMGFSVEDLRTHCQDNHRMAR
TVCICPVCAAVPLSQPSHIAHIANHLMFSPSHRATGDPMIDISATSQAEGSSLPQNSAVS
SGSGAQHTFSSSENSQVRFLLPGNRAPLADSDDFNMDNWEV
Download sequence
Identical sequences Q8IRV4
NP_001096871.1.81976 FBpp0112237 FBpp0112237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]