SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112256 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112256
Domain Number 1 Region: 110-280
Classification Level Classification E-value
Superfamily E set domains 2.17e-35
Family Arrestin/Vps26-like 0.049
Further Details:      
 
Domain Number 2 Region: 3-109
Classification Level Classification E-value
Superfamily E set domains 9.1e-20
Family Arrestin/Vps26-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112256   Gene: FBgn0042105   Transcript: FBtr0113344
Sequence length 359
Comment pep:known chromosome:BDGP5:3R:3611892:3613645:-1 gene:FBgn0042105 transcript:FBtr0113344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIICQILFHNNTQGVFYAGQMVAGQVTLSTDKAIQIKEMALEPGTRSYNFACPIPINCP
SSFEGTHGRIRYMVDVNIIQPWKYDSIFSRAFTVIQVMDINTYNSVSQVPVQAKTEKTFG
VWPFRSDPLTLELNLPQTGFVPGQTVPANVLIGNESKIRVHEVKVGLSMMITYYSDLSSG
SKCERKSVAKLKADGVLRNSRKMYDFQLMIPSTPPSCFHLCRIIKIGYQIEVVAKVKGMH
INGTLIMPVTICGVPISPSAVQYTPQSSGPEAPEQRALTLIEGEGAFAPAAPPYPWSEGS
TLSPPNYAEAMHSHSDSEKQSESGNAQEKSYKPLYPVFDLSTSTVEKSKEAALDKEEKK
Download sequence
Identical sequences Q4V467
NP_001097702.1.81976 FBpp0112256 FBpp0112256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]