SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112308 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112308
Domain Number 1 Region: 1051-1217
Classification Level Classification E-value
Superfamily Sec7 domain 2.09e-54
Family Sec7 domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 1253-1366
Classification Level Classification E-value
Superfamily PH domain-like 1.52e-31
Family Pleckstrin-homology domain (PH domain) 0.0013
Further Details:      
 
Domain Number 3 Region: 3-92
Classification Level Classification E-value
Superfamily PDZ domain-like 1.16e-18
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112308   Gene: FBgn0051158   Transcript: FBtr0113396
Sequence length 1521
Comment pep:known chromosome:BDGP5:3R:18413477:18434193:1 gene:FBgn0051158 transcript:FBtr0113396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEELKVVLRRSEQHSGFGFSLLGTTGPPHVIYDIVENSPAADCGAVEAGDVILKVNGTD
VHRYTTKEVLKCLRLSEQLVTLELKRDPKLKARIKEQLANTQSPHYVDIESPNIYDYHSS
STNSSPNHRPNAGGKGAATTPSQTGLRYKSPTHLPSLRQNSSPLLASGSTTTTTTATHTH
SHSRNSSASSTKIKVVETSITTSTTNVVGLTSPTGSVGGGVGGEATSPTFRPSRIPQALT
KCAVPKPVPVLHSPQNKRPRPSQIPTKAANGNGNGHTAHLPPQSLQHSNSYSGSPVTRQR
FADREPEREPEPNSAPPQPAKAPRFEAYMMTGDLILNLSRTPQTSNPLPAQAKKIDSLRD
SPSRLVNPRINGALAPRASGESSPTSSSSVDSPTNTSSDSVKREAKLLQKQQQQQQQTYQ
QQQQRDSINNSYNRKDSLTNDTLLMCEELEPDEEGEYVLEEDNKQQRQRQQQQRYRQQQN
QQRYEYYQNEDELEEQEEVEEEREEDQTHYDITNIETYQSGVGRGDDDDSDRQCLVDDDD
DDDAYDDEENDAGDEDYSTNSLGSGSAKQRLRALKQRTATRQQQRNRDAVDCAGRSGSGS
SSTTVKSEAGGLGLDETSFSVPTSPISLSTPLIDKETANSVPTSPEPSSLVPESSSGAGA
GAVVVRRHNGHVVRKCDAAGFRTSKSEDHLQQIQREGIAAVIPIDIDEDVNSSLNTLLDT
RQDSEDSQASDRDRIVWTYNAPLQPHQLAALQRQQQQQEQQFQQQQQQLHQQHLQQQQQL
QQQHQQQQQQQQQQQQQQLYGQQSHSNSHSSSISSSPQHSAVGSPASPTSVSSSVMSSSG
SKGALGLGSSSNGPMAAVQQQQLREREQGGQVAQPPSGIPGLLSCPGGGCGNNGGGGGIG
GGGNNDQSVSEAISNISSPDYQDDDNLLSSRDILGGMVLSDPSDSDSTILVSDAAAHQRQ
QLKQQLRAQQQQQRERERDRDRDREQSEHKVVIQVRGLDSNSSGGNGTNGRSEEDVVTLT
DEPLGTMTVGMRDASPPVSDDGSDVESLHSYHYSPKAVDMPSAIRLAKRLHSLDGFKKSD
VSRHLSKNNDFSRAVADEYLKHFTFEKKSLDQALREFLQQFSLSGETQERERVLVHFSKR
FLDCNPGTFNSQDAVHTLTCAIMLLNTDLHGQNINRKMSCAEFVDNLADLNDGENFPKDV
LKSLYQAIKTKPLEWALDEEAGDLQQQRANNSALGNVGLNPFLDPPELATAVEYKKGYVM
RKCCYDSSFKKTPFGKRSWKMFYCTLRDLVLYLHKDEHGFRKSQMSDNLHNAIRIHHALA
TKANDYTKKQHVFRLQTADQAEYLFQTSDSKELQSWVETINYVCAAISAPPLEGGVGSQK
RFQRPLLPSKQSKLMLKEQLDSHEVQLAQLDQELNEHKKGPIPSKGLALQNYKEKESYLQ
YELRRYRTYVSILSAKMLADQQQLELQAQQPSPASHEEEADTFPVGTTACTPPTPQSINQ
KDQQKEQQQQQPTNRKEKKKK
Download sequence
Identical sequences A8JR81
NP_001097874.1.81976 FBpp0112308 FBpp0112307 7227.FBpp0112308 FBpp0112308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]