SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112334 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112334
Domain Number 1 Region: 2-234
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.96e-68
Family IMD domain 0.0000248
Further Details:      
 
Domain Number 2 Region: 364-418
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000866
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112334   Gene: FBgn0052082   Transcript: FBtr0113422
Sequence length 630
Comment pep:known chromosome:BDGP5:3L:11129149:11157084:1 gene:FBgn0052082 transcript:FBtr0113422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEVTKLVDGVYRNILDRFNPGARQLIAAGKSYLKALHGAATASRLFNEALAKIAMNA
QQSGTGDIGSALMSVVNVNKEIQDQQMNILKAFYVDLLVPLETNLEKDTKVVQHEQKKFL
QQHKVRMESYQKAVSTMKKQRKKKATPENTEKELRSLQLLEDQKKKLDVFCDQSYKNAMT
QERRRYGFVLERQCSIAKHWMVYHTTGKTVIDNNFENWQEIAASREIIPPAAYESGYSTS
NGHNNNNISSSSSSGNNNTSGNMRRLERIKDGDDDHLQGHGAQLKKSRSIDAPYGDMRTL
HERENLSGLGGTGPAHYAQNSLPRAKSDFNLALVGTGQSSANKHKIIEEQLATLGDDQRG
DQRPLVKALYAYMPSGENQLSFEEGDRIALVGGKAKGWQFGENLRTQHFGWFPVAYTNAE
VAEVTTSGGRRYENMLMSYERNGGGSGSGSGGGGLRSYQQQQDYEAQLELMESHEATYRR
RRNHSAEDSSPTRMFGDTIKQQKKYRPGSGANPRPGPPPTLPAPVPNGPQSQSSRMLNSS
QSFCASNGGGVNAAVERRKQKLLNGVQSSKNHPSGKSGVAAKTSLHSSNDSGFANEPPPQ
PEVDYSDEEPATQRVAIRSRGIYRNYSIDY
Download sequence
Identical sequences A8JNR3
FBpp0112334 FBpp0112334 NP_001097582.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]