SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0112362 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0112362
Domain Number 1 Region: 101-421
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.57e-84
Family NAD kinase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0112362   Gene: FBgn0053156   Transcript: FBtr0113450
Sequence length 450
Comment pep:known chromosome:BDGP5:2R:9435749:9440666:-1 gene:FBgn0053156 transcript:FBtr0113450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREEDLQLALQMVASTSVSSSLEEENDGAAATSPGNSPKPLRRVLDLSERRKQFRRTRSL
NAPSPVQQFGPCGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKVSDASVLAPFVYL
VDWLLQEKNMVVWVESAVLEDVQLNENVRFKAIRDKLVTFKDGRDDLTDRIDFIVCLGGD
GTLLYASLLFQQSVPPVMAFHLGSLGFLTPFRFDNFEEQLTSVLEGHAALTLRSRLRCVM
HRRSDRKHEAKTLEADLDGEARPAANSILVLNEVVIDRGPSPYLSNIDLFLDGKYITSVQ
GDGLIVSTPTGSTAYAAAAGASMIHPSVPAIMVTPICPHSLSFRPIVVPAGVELKISVSP
ESRNTSWVSFDGRNRQELFHGDSLRVTTSIYPVPCICAQDQISDWFASLADGLHWNVRKR
QKCLDELSDLTASGSEDTLDEIENMKLYDV
Download sequence
Identical sequences A8DYC9
NP_001097302.1.81976 FBpp0112362 FBpp0112362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]