SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0113020 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0113020
Domain Number 1 Region: 470-513,557-702
Classification Level Classification E-value
Superfamily Fibronectin type III 1e-23
Family Fibronectin type III 0.00012
Further Details:      
 
Domain Number 2 Region: 241-337
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 3 Region: 326-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000534
Family I set domains 0.028
Further Details:      
 
Domain Number 4 Region: 36-78,108-115,165-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000191
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0113020   Gene: FBgn0040388   Transcript: FBtr0114528
Sequence length 1110
Comment pep:known chromosome:BDGP5:X:2338200:2364036:-1 gene:FBgn0040388 transcript:FBtr0114528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEIRLVVVLLVLMTTCIYTLQASDSNSSVATTLGVLFERAPESAVAPKGDEVVFECELN
LKPDRLEWRFRRGDSSEPYLYLRPSAGYNVTSGSDGLAWRLRIYVSAQTAGDYQCVAWYG
PGALASTPARLALVSIALDVGQGSMGARSSIRWSVAPKNCLLIRCGSVISNPPAIWSFYR
NGKKLPQSELLPGAAGALVLDTVTAKDAGNYSCVATNSITGDELRLPQTIELRVDYTDRT
PPYFLQRPPIEYSARPGETVVLECPGVGSPRPRVIWSSPNVVEIYNNRSTILSYGLQITD
VKPEDQGSYICMLDNGIAPPIDHTIKLSVLQRPTILRGPAATLTNESNPLLLDCSASGNP
QPDIYWLINGEDATKDPEAVVDNRSLQLKRVQKRHAGVVQCFAKNILGETSEGNILRVNP
LEITGEDDEPLGEVPVWPVHESNTGMGTSSTSGGSKNKSGRRKFKASMVPPSRPNVTRLS
DESVMLRWSVPQNSGLQITFFKVQYRMLGDGKNRRKNWQTTSDNIPYGNAHGSGPGQGNS
HWRARNRDREYEMGNPPKNFTSSVTGLTAGKYYRFRIVAVYSNNDNKEGNTSLKFFLQNG
TSKSNLPVPELREVETLSESAVVLHWSLVSSTQNEDIDGYYAYYRPADSAAEYLKATVDG
GMSRSFKIDLLRPGTPYEFKLQSFNSDAASEFSAIRQARTRKTHEQPASSSATPVPANKA
VEQHQNSLYPLIAGAAGGGILLLIASLVVCLCLKRRENSQPEDENKPQLEHIQADFVTSA
VLGVGGHHKSGDVRRLNGVIPRMNITPNPLAQETASDKSPMFQNRNVMELRFLPPLANGN
GNGNCMARDLALERSNAEEQQDEDGHEDEKGLPAVASSSCETLEACDAAIKLNLPQKHDQ
EQLDAPNAVLEAPSKPLPPLPKKPANGAGQNNSGLHQNGLHHAQPYHPPGTPTLMHKRLD
YHQQPPPVPPHSAYYQQAPTHQPSPMMERSVRGHQQPGGFHMEEGTPTPTRIPSLRRQRR
TSGNQQVHNSHSNLNIGLSHHNNNNNNLPPHHQHLHHHPGHPGGLVGIPIVPGSPRVQRS
PMPSRAMIKRTRLGSHTDNISSGSLNSIEV
Download sequence
Identical sequences FBpp0070441 FBpp0113020 7227.FBpp0113020 FBpp0113020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]