SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271718 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271718
Domain Number 1 Region: 1-147
Classification Level Classification E-value
Superfamily TPR-like 5.31e-39
Family Tetratricopeptide repeat (TPR) 0.0000274
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271718   Gene: FBgn0039969   Transcript: FBtr0273210
Sequence length 148
Comment pep:known chromosome:BDGP5:2R:1491300:1492333:-1 gene:FBgn0039969 transcript:FBtr0273210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLLNEVVPQEDLERFEKKYHHELELDGEVTTDTKFEYAFCLVRSRYTNDVRKGIMILE
ELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQVRSLEEYIKKEIDKE
VAKGMVVAGGAALVLGGILGLGIAMARK
Download sequence
Identical sequences NP_001137608.1.81976 FBpp0271718 FBpp0271718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]