SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271719 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271719
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily TPR-like 9.1e-23
Family Tetratricopeptide repeat (TPR) 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271719   Gene: FBgn0039969   Transcript: FBtr0273211
Sequence length 92
Comment pep:known chromosome:BDGP5:2R:1491300:1492333:-1 gene:FBgn0039969 transcript:FBtr0273211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILEELARTHPDGRRDYIYYLAFGNARIKEYTSGLKYCRAFLDIESNDQVRSLEEYIKKE
IDKEVAKGMVVAGGAALVLGGILGLGIAMARK
Download sequence
Identical sequences FBpp0271717 FBpp0271719 FBpp0271717 FBpp0271719 NP_001137609.1.81976 NP_724420.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]