SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271862 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271862
Domain Number 1 Region: 399-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.58e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 432-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000209
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Weak hits

Sequence:  FBpp0271862
Domain Number - Region: 624-673
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.046
Family FCH domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271862   Gene: FBgn0020378   Transcript: FBtr0273354
Sequence length 715
Comment pep:known chromosome:BDGP5:X:9623681:9649831:1 gene:FBgn0020378 transcript:FBtr0273354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTDMTPTAGQLYGSQIPAMGMNISNIATHLQKPQVNPDHPSLRGTPLAMLAAQCNKLSN
KSPPPLADAAVGKGFHPWKKSPNSPAAGSSGSSGGGGGGGGSSAGQHSPCAISAASSSSS
SGSSGGQSSRSLSSSASTMVNITASRPLASSCAAVGGGSTGSSSSASGSQSSSTASAVAA
AYGGDLYFPNTSTSNMDNHHMHQGLLGKVEAGAAAFGGVYSRHPYDWPFNAVTHKEAASV
NSGWWDMHSAAGSWLDMGGAGMHSTMANYASENYSSALSHSLLGSGQHLLQDTYKSMLPG
QGVGVGVGVGMGGFSLPHSSPSAAAAAAATAAAAAGGSPQGGSPSTPSPRSQRRYAGRAT
CDCPNCQEAERLGPAGVHLRKKNIHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWL
FCGKRFTRSDELQRHLRTHTGEKRFACPVCNKRFMRSDHLAKHVKTHNGTANHQANGHNG
GLKKGSSESCSDSEEAANQSGESNGLGGVGSGPQTGGAGGGGGGSSSGNGAGTLAVSGSV
TTGAGAGSGTGSSNSNSNSGGSSGSVSGSVSGSGSHPGTPTSLHAHSANGTSSSLLGGGL
HLATPHQMVAAGGSPVMLHQQQQQQQHQQQQQQQQQQQHQQQQQQQHQQQQQQHQQQQQQ
HHQQQQQHHHQQFGQQQHPHAHHLHHHAHHAHHLATGGSPGLDPSSLVDIKPPMV
Download sequence
Identical sequences A8JUN6
FBpp0271862 FBpp0071316 FBpp0271862 7227.FBpp0271862 NP_001096927.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]