SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0271958 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271958
Domain Number 1 Region: 41-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000393
Family V set domains (antibody variable domain-like) 0.078
Further Details:      
 
Weak hits

Sequence:  FBpp0271958
Domain Number - Region: 146-186
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0934
Family C2 set domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271958   Gene: FBgn0053179   Transcript: FBtr0273450
Sequence length 217
Comment pep:known chromosome:BDGP5:2L:16973091:16993984:1 gene:FBgn0053179 transcript:FBtr0273450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPATNCRYSLAYGALFILLLQLCFESVECLTMTEIKIPKHIMRHEDAVLGCKFDLDGES
LYSVKWYKDGFEFYRYVPRDMPPGQVFPLPGVDVELQNSTDVVVVLRSVSLQSTGRYRCE
VSGEAPSFQTVSGHEDMIVVVTPKHGPQITGGQPRYQIGDMVRVNCTSAASRPVCHLSWL
INGMHANRSLLRPYEPLIVGREGLEVARLGLEFRVRG
Download sequence
Identical sequences Q1EC42
FBpp0271958 FBpp0271958 NP_001137832.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]