SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288542 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288542
Domain Number 1 Region: 656-763
Classification Level Classification E-value
Superfamily ARM repeat 3.28e-61
Family PHAT domain 0.00000146
Further Details:      
 
Domain Number 2 Region: 596-654
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000471
Family SAM (sterile alpha motif) domain 0.000061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288542   Gene: FBgn0016070   Transcript: FBtr0290103
Sequence length 1109
Comment pep:known chromosome:BDGP5:3L:8983417:8990194:-1 gene:FBgn0016070 transcript:FBtr0290103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYATGTDNAMTSGISGQTNNSNSASNEMQPTTSTPTAAHKEATSTATTTATYANGNPNS
NANPSQSQPSNALFCEQVTTVTNLFEKWNDCERTVVMYALLKRLRYPSLKFLQYSIDSNL
TQNLGTSQTNLSSVVIDINANNPVYLQNLLNAYKTFQPCDLLDAMSSSSSDKDSMPCYGS
DFQITTSAQCDERKLYARKEDILHEVLNMLPLLKPGNEEAKLIYLTLIPVAVKDTMQQIV
PTELVQQIFSYLLIHPAITSEDRRSLNIWLRHLEDHIQAAAAGLTNRSYFLQPSPQLVAG
GSSTGSGSCSSSATSSSTASCSSVASSSLCPASGSRSSRTNDWQTIAPPSKQLQNKLAGD
WRGNGGGSSSGSINPLCDNLNGITLNELASSQNSLGLSLEGSSSLVNGVVAGAGSMLGIA
GGDDHDTSFSKNGTEILDFDPVTADMGEACSLASSSLCGRNGGNPVEDRSQPPPNLQQQL
LQPPPYASILMGNVGDQFGEINRWSLDSKIAALKTRRSNSLTTQTISSCSSSSNSSVITV
NDNCSNSTENLAQFANKPRSFSLSIEHQRGALMNSGSDTRLDEFKPNYIKFHTRNVGMSG
IGLWLKSLRLHKYIELFKNMTYEEMLLITEDFLQSVGVTKGASHKLALCIDKLKERANIL
NRVEQELLSGQMELSTAVEELTNIVLTPMKPLESPGPPEENIGLRFLKVIDIVTNTLQQD
PYAVQDDETLGVLMWILDRSIHNEAFMNHASQLKDLKFKLSKMKISMVPKMHHVKPAGVG
PNNGNINKPRWNGKTRKCDTKNGSNDRINNRKNSNDMLNFSLNCLPHPLPHHSQQAPPPL
PQFDYNGYGGGPSHQPQYKSSSYPSFMGNPQQQPPPPPSSKSHHHPQQMQQMLQQHNHFP
ALPQQTPPQSHRRSLNNLILVAGGPQQPQQLIFKPGQGVLTNNGSNDNLVLERNQQSQQQ
QQQRKLSGGVSSAEQQPKKTMAAVVMVSNPNQNQDQHDQPQILINNNNNNSMLNNNLINQ
QQLQLLAAAAAAVGSGSCLCSNGGGGACVHNICHQSSKNNNHGVDHCLSQSPLGSLGMSP
HVTEYKMNDFKSLEQLETLCRQMTEQAMN
Download sequence
Identical sequences FBpp0288542 FBpp0076277 NP_001137924.1.81976 FBpp0288542 7227.FBpp0288542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]