SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288670 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288670
Domain Number 1 Region: 1346-1650
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-77
Family Protein kinases, catalytic subunit 0.00000000836
Further Details:      
 
Domain Number 2 Region: 337-485
Classification Level Classification E-value
Superfamily L domain-like 1.96e-41
Family L domain 0.0000185
Further Details:      
 
Domain Number 3 Region: 641-806
Classification Level Classification E-value
Superfamily L domain-like 1.47e-33
Family L domain 0.00014
Further Details:      
 
Domain Number 4 Region: 877-967,1143-1171
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-16
Family Fibronectin type III 0.0077
Further Details:      
 
Domain Number 5 Region: 1146-1301
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-16
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 6 Region: 519-649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288670   Gene: FBgn0013984   Transcript: FBtr0290231
Sequence length 2144
Comment pep:known chromosome:BDGP5:3R:17398221:17417843:-1 gene:FBgn0013984 transcript:FBtr0290231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNMPRGVTKSKSKRGKIKMENDMAAAATTTACTLGHICVLCRQEMLLDTCCCRQAVEAV
DSPASSEEAYSSSNSSSCQASSEISAEEVWFLSHDDIVLCRRPKFDEVETTGKKRDVKCS
GHQCSNECDDGSTKNNRQQRENFNIFSNCHNILRTLQSLLLLMFNCGIFNKRRRRQHQQQ
HHHHYQHHHQQHHQQHHQRQQANVSYTKFLLLLQTLAAATTRLSLSPKNYKQQQQLQHNQ
QLPRATPQQKQQEKDRHKCFHYKHNYSYSPGISLLLFILLANTLAIQAVVLPAHQQHLLH
NDIADGLDKTALSVSGTQSRWTRSESNPTMRLSQNVKPCKSMDIRNMVSHFNQLENCTVI
EGFLLIDLINDASPLNRSFPKLTEVTDYIIIYRVTGLHSLSKIFPNLSVIRGNKLFDGYA
LVVYSNFDLMDLGLHKLRSITRGGVRIEKNHKLCYDRTIDWLEILAENETQLVVLTENGK
EKECRLSKCPGEIRIEEGHDTTAIEGELNASCQLHNNRRLCWNSKLCQTKCPEKCRNNCI
DEHTCCSQDCLGGCVIDKNGNESCISCRNVSFNNICMDSCPKGYYQFDSRCVTANECITL
TKFETNSVYSGIPYNGQCITHCPTGYQKSENKRMCEPCPGGKCDKECSSGLIDSLERARE
FHGCTIITGTEPLTISIKRESGAHVMDELKYGLAAVHKIQSSLMVHLTYGLKSLKFFQSL
TEISGDPPMDADKYALYVLDNRDLDELWGPNQTVFIRKGGVFFHFNPKLCVSTINQLLPM
LASKPKFFEKSDVGADSNGNRGSCGTAVLNVTLQSVGANSAMLNVTTKVEIGEPQKPSNA
TIVFKDPRAFIGFVFYHMIDPYGNSTKSSDDPCDDRWKVSSPEKSGVMVLSNLIPYTNYS
YYVRTMAISSELTNAESDVKNFRTNPGRPSKVTEVVATAISDSKINVTWSYLDKPYGVLT
RYFIKAKLINRPTRNNNRDYCTEPLVKAMENDLPATTPTKKISDPLAGDCKCVEGSKKTS
SQEYDDRKVQAGMEFENALQNFIFVPNIRKSKNGSSDKSDGAEGAALDSNAIPNGGATNP
SRRRRDVALEPELDDVEGSVLLRHVRSITDDTDAFFEKDDENTYKDEEDLSSNKQFYEVF
AKELPPNQTHFVFEKLRHFTRYAIFVVACREEIPSEKLRDTSFKKSLCSDYDTVFQTTKR
KKFADIVMDLKVDLEHANNTESPVRVRWTPPVDPNGEIVTYEVAYKLQKPDQVEEKKCIP
AADFNQTAGYLIKLNEGLYSFRVRANSIAGYGDFTEVEHIKVEPPPSYAKVFFWLLGIGL
AFLIVSLFGYVCYLHKRKVPSNDLHMNTEVNPFYASMQYIPDDWEVLRENIIQLAPLGQG
SFGMVYEGILKSFPPNGVDRECAIKTVNENATDRERTNFLSEASVMKEFDTYHVVRLLGV
CSRGQPALVVMELMKKGDLKSYLRAHRPEERDEAMMTYLNRIGVTGNVQPPTYGRIYQMA
IEIADGMAYLAAKKFVHRDLAARNCMVADDLTVKIGDFGMTRDIYETDYYRKGTKGLLPV
RWMPPESLRDGVYSSASDVFSFGVVLWEMATLAAQPYQGLSNEQVLRYVIDGGVMERPEN
CPDFLHKLMQRCWHHRSSARPSFLDIIAYLEPQCPNSQFKEVSFYHSEAGLQHREKERKE
RNQLDAFAAVPLDQDLQDREQQEDATTPLRMGDYQQNSSLDQPPESPIAMVDDQGSHLPF
SLPSGFIASSTPDGQTVMATAFQNIPAAQGDISATYVVPDADALDGDRGYEIYDPSPKCA
ELPTSRSGSTGGGKLSGEQHLLPRKGRQPTIMSSSMPDDVIGGSSLQPSTASAGSSNASS
HTGRPSLKKTVADSVRNKANFINRHLFNHKRTGSNASHKSNASNAPSTSSNTNLTSHPVA
MGNLGTIESGGSGSAGSYTGTPRFYTPSATPGGGSGMAISDNPNYRLLDESIASEQATIL
TTSSPNPNYEMMHPPTSLVSTNPNYMPMNETPVQMAGVTISHNPNYQPMQAPLNARQSQS
SSDEDNEQEEDDEDEDDDVDDEHVEHIKMERMPLSRPRQRALPSKTQPPRSRSVSQTRKS
PTNPNSGIGATGAGNRSNLLKENWLRPASTPRPPPPNGFIGREA
Download sequence
Identical sequences P09208
NP_001138093.1.81976 NP_001138094.1.81976 NP_001138095.1.81976 NP_524436.2.81976 7227.FBpp0288671 FBpp0083519 FBpp0288669 FBpp0288670 FBpp0288671 FBpp0083519 FBpp0288669 FBpp0288670 FBpp0288671 FBpp0083519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]