SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288691 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288691
Domain Number 1 Region: 5-52
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000884
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288691   Gene: FBgn0085318   Transcript: FBtr0290252
Sequence length 102
Comment pep:known chromosome:BDGP5:3R:19332630:19333011:-1 gene:FBgn0085318 transcript:FBtr0290252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSYPCIFCLDEQRYPHHISCGHSFCSACLKKYLELGRDSRCPLCRRDFRADIQPSLSNN
SAEEVESLPGTEMDTLVLTLSEQECWFFEQLYRDVELTSRRD
Download sequence
Identical sequences B7Z0P3
NP_001138100.1.81976 FBpp0288691 FBpp0288691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]