SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288698 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288698
Domain Number 1 Region: 156-490
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.61e-94
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000355
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000002
Family Zf-UBP 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288698   Gene: FBgn0013717   Transcript: FBtr0290259
Sequence length 496
Comment pep:known chromosome:BDGP5:3L:18611906:18615229:-1 gene:FBgn0013717 transcript:FBtr0290259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSETGCRHYQSYVKEHSYDTFRVIDAYFAACVNRDARERKAIHCNCFECGSYGIQLYACL
HCIYFGCRGAHITSHLRSKKHNVALELSHGTLYCYACRDFIYDARSREYALINRKLEAKD
LQKSIGWVPWVPTTKETNLLLANARRRLVRPNQTIGLRGLLNLGATCFMNCIVQALVHTP
LLSDYFMSDRHDCGSKSSHKCLVCEVSRLFQEFYSGSRSPLSLHRLLHLIWNHAKHLAGY
EQQDAHEFFIATLDVLHRHCVKAKAEHESKSNSSGSGSGTNSSNSSSSHCYGQCNCIIDQ
IFTGMLQSDVVCQACNGVSTTYDPFWDISLDLGETTTHGGVTPKTLIDCLERYTRAEHLG
SAAKIKCSTCKSYQESTKQFSLRTLPSVVSFHLKRFEHSALIDRKISSFIQFPVEFDMTP
FMSEKKNAYGDFRFSLYAVVNHVGTIDTGHYTAYVRHQKDTWVKCDDHVITMASLKQVLD
SEGYLLFYHKNVLEYE
Download sequence
Identical sequences Q9VVR1
FBpp0288698 FBpp0288698 NP_001287106.1.81976 NP_524140.2.81976 7227.FBpp0288698 FBpp0288698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]