SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288716 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288716
Domain Number 1 Region: 827-993
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.26e-18
Family Growth factor receptor domain 0.0078
Further Details:      
 
Domain Number 2 Region: 284-361,396-463
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.73e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 738-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000383
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 4 Region: 588-713
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 779-827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000218
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 6 Region: 1109-1175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000264
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 7 Region: 547-583
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000494
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 8 Region: 467-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000661
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1181-1236
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000751
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 10 Region: 58-115
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000514
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  FBpp0288716
Domain Number - Region: 248-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000242
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 982-1008
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00739
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 521-557
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0225
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288716   Gene: FBgn0035798   Transcript: FBtr0290277
Sequence length 1618
Comment pep:known chromosome:BDGP5:3L:7555710:7562599:1 gene:FBgn0035798 transcript:FBtr0290277 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAAKYVLCALACVAFASASPSSERKRKNVMNIPEDPKVSDSLAASLDMSCSSAKILPPE
INHGRVSVFDRRRRGKKVFLVAFFVCDDNYDFENGISEMFCSNQKWVDEIPTCIPQLNFE
EHDEKVGYDLEDYSDETVPNDYVENSDIDEDDDEEVSEREPPPPPPPPVVDGADSKPEPQ
IVIEINDDHANEVVESEPALAETETENEVLENETPLKAEVQTDVLNSSNASVKVTNDPYE
PTFLDNNCGEDNGGCAHICKRLLYPDENQPINKCDCREGYTLDPNDYASCLDIDECLESN
GGCSEICENLPGEYKCSCQEGYYLDESGKSCVDINECANPELSSNCQGACENLPGSYRCV
EPLEENPEITEVVENPIEKTNEVPVNVSESQPAGKTCNSGFQLSADGTDCQDINECEVDG
PEDLDNNAVCQQKCENTIGSFRCTCVEGYHLLEDQRSCALDSCTDLENPQLNRTRCAHEC
QDLPEGSYRCVCPKGYELSEDQHSCLVQESPCSTEKGVEKCSPGTCLASEDNTSFSCICP
TGYRSEAFSCQDIDECAEDTHLCSHTCQNTPGGYQCQCPEGLNLVEEYTCLAENLCEVNN
NGCEQICLTARGGVCACREGFRLSADGKSCEDVDECLVNNGGCQQVCRNLPGSYGCICAA
GYELLKLDGIRGYCFDIDECSQRTHGCSDQMLCENLNGSYTCLCPPGYALGLDNHIVTSL
NSSFITDSTSSETPSAHTCLDIDECSLANGNCSHFCQNEPGGFQCACPLGYALSEDMRTC
QDIDECLDSNGQCSQLCLNQPGGFACACETGFELTPDGFGCADIDECSQDYGNCSDICIN
LLGTHACACERGYELAKDKLSCLDVDECAGLLSGGCSHECINKAGTFECGCPLGYILNDD
GRSCSPALVGCPPGTQRSADGCAPIECNPGYTLGSDDKCVDIDECQKQNGGCSHRCSNTE
GSFKCSCPPGYELDSDQKTCQDIDECDQDKTSCITGTCINEIGGFRCEFPKFPVLPEIPT
ASSLPESPKIELKTPKYPDFTELSNEIPENPKKPAEFDYPEPKFPSLPKWEGLPKLPPLA
DIPTSKAPVPLRPEVPKSLWVNQLQPRDLCPRFQAPRNGKSHCNRYRHKQKLFYYSRCRI
SCNSGYILQGPEIKSCDANGIWEGPETKCVAINQPRAQSPGICPALKPAQNGVILPASCT
QGPSRFGDVCRLQCNAGFVSTGSLLTACMMLQGWSFGADLNCQPFGNGLLGNQLSPMWNS
PKTVTPHQIQNVEQIRPYINCPENVVILLHAGEQKAHVTLQRPQTNVKNGRLVAHPAWAG
QLQGHLPAGVHKVDFRVNDPETKLTIKCHTIITVKAATPRESNPFTLFRISDYSRSSLPR
PAPFATLSTGSSFSFPAFKALDATPKPVSFTKFQVFPDSESSEHSKLGSSSFFRLEPLFH
ESSKLISAAPASSENTRVDLGSDTSNYCPPSIEVYLKENQNLRSVVWDEPRFEGKLLKIY
KSHFPGSLFKVGDHAIKYEATTTDGKTLSCTFFIYVRSAKPTPAPTEPKISFDSEPETLS
DVSQTYVVCPDKEPVRVTAESVSLPVGCTLKNIRPKSRSPKELKRGKLTSLWHQYTNF
Download sequence
Identical sequences Q9VS89
FBpp0288716 7227.FBpp0288716 FBpp0288716 FBpp0290439 FBpp0290440 FBpp0288716 FBpp0290439 FBpp0290440 NP_001137905.1.81976 NP_648137.3.81976 NP_996014.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]