SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288734 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288734
Domain Number 1 Region: 681-706
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000628
Family Ran binding protein zinc finger-like 0.0036
Further Details:      
 
Weak hits

Sequence:  FBpp0288734
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000586
Family B-box zinc-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288734   Gene: FBgn0031857   Transcript: FBtr0290295
Sequence length 834
Comment pep:known chromosome:BDGP5:2L:6767096:6770949:-1 gene:FBgn0031857 transcript:FBtr0290295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTHQLLNKNVRTMPSWVMEANDRIGPKPPPTPPNGVAGGLPKAPALPPKAKSTPEPDYE
IIEFSSQQYSNEPMKTTVIRTKTPDNKLKCTLCGSQNPWVTCAECAGQIFCASCDDMFHK
HPKRKQHMRKAVEQGTPPIPPKAQAGGGAPPPVAPPRRSKRGLLTPFLGRKDQMLPPPSP
TPSHKSLGGWRGSLGGGATPPVPPIATSSANQMNNRPLPDPPRSEGGGSSRSGTPKSVFD
TIQRPPSVQLEKIKSKASATLDRMAILQQRYRQQKARQDLSANSEQAAGAQRRQMSTSVF
NLNSNPRRPLSEAQNGGAWLANQRIQQAQSLAQLNCAGCQQSQQHPGWAQHPHQALPQHQ
HPDQWSQFGSQQQFNNSNLSLNVGPGYMSQQHHPHYPPPVFMTQRGMMPNVYPGAPGYPM
MHPGVMGMPPSAASRAASRSRYAASPTPSRKSMSLRRKRNSYVDDELTDDEDSDQDDRRS
LVSNRSGMTSASRSQHHQNHIQPRQRRLSSASQLIASDELDGDQVHHKMRNRRGSIAKSV
QSEWLPERRENEGTLTRNKTATDSARTSRIYSDLESEGSGARALVQAKIQQKLQEADQHK
SSKKAEPKRKPEMKDENTQAAAVVQKVVVPPAHEESASEYEEVVEEVTASESEAEAQTAP
DPQEVPDEIGADDLGPPPSTPDHEWECEFCTFVNEPNIKICSICCKTPSKPPVQPNKAKK
VEEKPQPPAEKSNNIKASSKTETKPVQKPTTKSQQPSQKSVAALSKTTHTNSTSSSKASP
AVNSKTTSSIPIKTPSKSTLKTSSENESDNSLAKSLLHKGRIQKRISFFEGTKT
Download sequence
Identical sequences Q9VM88
NP_001260156.1.81976 NP_609072.2.81976 FBpp0288734 FBpp0303659 FBpp0288734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]