SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288794 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288794
Domain Number 1 Region: 178-254
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000278
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 2 Region: 243-301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.00097
Further Details:      
 
Domain Number 3 Region: 121-175
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000208
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288794   Gene: FBgn0032797   Transcript: FBtr0299519
Sequence length 314
Comment pep:known chromosome:BDGP5:2L:19514510:19516708:-1 gene:FBgn0032797 transcript:FBtr0299519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRLLLQCLVTTILVYKVISVPTSTMSTSIQTTSEIPQQDDDDDDWEEDDDSLESDDDGR
VYKNPRNSPSTECPRDEEQATLLGQKCLRKCSSDEDCKSKKKKCLCDGVCGNSCIKPDRE
CPELAQPSLGQVTVAGRHFGARASYACPHGYHVVGLQSRLCQADGNWAGAEPACKQNIYC
LKPPQIEHARNSALPEQETFDLDSTVQYHCHTGYVTNGFPRAKCLAIDNLASWYGPDIQC
EPRSCGQPPDPAYGWHAGECYTYGCKITYNCGTGYELVGKHERYCQSDGSWTPKELPTCV
SDSANVTTTQASLS
Download sequence
Identical sequences Q058W1
NP_001137840.1.81976 XP_016944904.1.48971 XP_016962079.1.21709 XP_017069724.1.81094 FBpp0288794 FBpp0288794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]