SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288821 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288821
Domain Number 1 Region: 422-518
Classification Level Classification E-value
Superfamily Immunoglobulin 3.33e-19
Family I set domains 0.0072
Further Details:      
 
Domain Number 2 Region: 238-327
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-16
Family I set domains 0.044
Further Details:      
 
Domain Number 3 Region: 324-416
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000107
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 30-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000649
Family I set domains 0.029
Further Details:      
 
Weak hits

Sequence:  FBpp0288821
Domain Number - Region: 138-227
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00011
Family I set domains 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288821   Gene: FBgn0263218   Transcript: FBtr0299546
Sequence length 543
Comment pep:known chromosome:BDGP5:3L:7167219:7183017:-1 gene:FBgn0263218 transcript:FBtr0299546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWISSRFFVILLLLNLDNTCSEPFEAHLRGPGFVMEPPGRVEFSNSSGGWLDCSASGSPQ
PTVDWVHADGSAVTEIHGVRRVLRNGTLVLMPFAAAAYHQDVHNTIYRCIASNSVGRIVS
RDVQVRAVVAQAYKVDVEVLSAARGCTAILRCVVPTFVKELVRVVSWVHEPAIYIYPSLQ
GDGKFHLLPTGELLIHNLQESDESQSFRCRSMHRLTRQVVVSSPTRLRINSHRGIISPSV
VEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGAGPLPVLSGPRVRLLGPILAIEAV
TGEDSGVYKCTAGNVGGEASAELRLTVATPIQVEISPNVLSVHMGGTAEFRCLVTSNGSP
VGMQNILWYKDGRQLPSSGRVEDTLVVPRVSRENRGMYQCVVRRPEGDTFQATAELQLGD
APPVLLYSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGD
VISHVNISHVMVEDGGEYACIAENRAGRVQHAARLNIYGTLYSHTHGMHSKHTDAHMRKM
LMA
Download sequence
Identical sequences H5V8G2
FBpp0288821 FBpp0288821 NP_001137897.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]