SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288957 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0288957
Domain Number - Region: 100-145
Classification Level Classification E-value
Superfamily RING/U-box 0.000194
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288957   Gene: FBgn0259195   Transcript: FBtr0299679
Sequence length 182
Comment pep:known chromosome:BDGP5:X:15468980:15469716:-1 gene:FBgn0259195 transcript:FBtr0299679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKMDPKSHQKLFREMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDV
NNSLEDTNYMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGH
IYDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIKNETSSD
ED
Download sequence
Identical sequences Q9VXT4
FBpp0288957 FBpp0288957 FBpp0288957 NP_727866.2.81976 7227.FBpp0288957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]