SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0288958 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0288958
Domain Number - Region: 99-144
Classification Level Classification E-value
Superfamily RING/U-box 0.000185
Family RING finger domain, C3HC4 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288958   Gene: FBgn0259196   Transcript: FBtr0299680
Sequence length 181
Comment pep:known chromosome:BDGP5:X:15449286:15450078:-1 gene:FBgn0259196 transcript:FBtr0299680 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKMDPKSHQKLFKEMAEVVSNSSDDGEKLLTKNSSNTIEKSEEVCKERPEAVEQMRIDV
NNSLEDTNMNAVESEAQKNIAGLDEDLIMEDFGVEVVPFHDPWSKLLIKHPVRNKRCGHI
YDRETVLMIIKDNIGILCPVRDCPNLSDIKLEHLVKDPDVEQELQKRKSDKIQNETSSDE
D
Download sequence
Identical sequences Q9VXT8
FBpp0288958 NP_727865.2.81976 7227.FBpp0288958 FBpp0288958 FBpp0288958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]