SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289115 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289115
Domain Number 1 Region: 2252-2553
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.56e-64
Family Tandem AAA-ATPase domain 0.0000775
Further Details:      
 
Domain Number 2 Region: 1977-2250
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.42e-58
Family Tandem AAA-ATPase domain 0.000036
Further Details:      
 
Domain Number 3 Region: 4563-4619
Classification Level Classification E-value
Superfamily BRK domain-like 1.7e-17
Family BRK domain-like 0.00061
Further Details:      
 
Domain Number 4 Region: 1926-1994
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000412
Family Chromo domain 0.0047
Further Details:      
 
Domain Number 5 Region: 1859-1919
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000192
Family Chromo domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289115   Gene: FBgn0086902   Transcript: FBtr0299837
Sequence length 5517
Comment pep:known chromosome:BDGP5:2L:210735:250823:-1 gene:FBgn0086902 transcript:FBtr0299837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGNAQNMFHGNHQGDPYYRYDAAAAAAAAAAANPRAMGPPGGYPPRHRPPHPLQQQPQY
PSYQPTAENLYGLGAADHQAAMGLGVGVGVGAGMGDLSGWGAAPSVPGQAAAYPGAGLGA
YGHPQAAPPSQQQRQSNASAYRQHMPAYGQQDQQKLASYGAQQSMMAGYGSLAPQQQQQQ
QPPTPQQQQQAQQVQQQAQQQQQQQQQQSQQQARLPQHYPQAPGQHPLYPGVGAPTVQAG
QPPTPQAYAHSPYGSPMQHQPSRGAPQHVGYGHTGLDQASAYGQHVPGGAPPGHHLSAQQ
QQAAQQLGAHQQQQLQSQQQQQAQQQQPHVSLMQQQQLPGAGLPPPHMGMPPSYGSHHQQ
QQQQQQTQQQQQQSAPPYMSSSKHQQAAAQLNSSPQYRAPFPQLSPQMSPRPPTMSPHPQ
MSPRPVGVSPAKPPPPQQQQQQTQAQQPQQVVSNQPSQHSIQGMVGLPSPRPQPPTSGAG
GAGAKGPAPVAAPVNTLQALEQMVMPSQALGLPPMDYPSAYRSAVGPRMPASPQQQQQQH
QQWGAAHGAQHLAALQQQQAQQQQQQVQQQQQAPPQQQQQAAMLQAQQQHHQQQLSMYGQ
PMGQQPQTAQQQVVPPVTSQPPVVAASQQQQQQQHQQQSLNDQLQHSINDIVGGGNSSGA
TGGAQNQHQQQPQLAAMSSPLHQQNLPNMHHLIQPTMETTQPTQQQQQTSQQQQQPQQPQ
ATLTSPHHQQMQHQSPIHQQQQSPHHQQHLPSYNQSQQQFDPFANILGDNQPAASQQTMS
PAHVSSPVPAQMQQQQHQTQQQPSQQVPQSQQQQVSQPQQQTQQQQPSTPSHHLSSILNE
TANSNDSSTLAVAANDSNNSSSNSSTNSIVNNQPTSVHDSNSQSSINSSSNNQQQLLMDN
TNSHGGNSESAQNAGVDVGLFDNNSMSSNSAAVAAVASNAASAAAALLDSNSQSSNAEFE
KNQSEGEGLGVVEGVIANETDLPQDENSVSKTQDITLSTELPTIQDDLQEKPTAEMEQTQ
LGQSLGDLSKSLLEEPKTVEESGEDKSQSAPGVAPPADPIIPVTQPPQQQMPPIGMPMHP
IAPGYEAQAQGQGHMPPMMPPYGGAPGMYPPYPMLHQQEIAALQQQIQELYCMPPGHELQ
HQDKLMRMQERLNLLTQHEVNDQCAGGPQCLLFQNVPPMYGPPGNPLLNQQMVESPQVSS
TTGRGRGKSANKPRKPRAKKGEKAQVGQQQDLMDISGNVAMGAANAVSSIPTTQLPVSED
CVTQGAGDTSVVGMLEYSEGMGDLSQDVHSANELDTSTDGSGKKKKPRKPRTPKDPNKPP
RDRTPKAKKPKDPNDPNSTETPAAVKKRAGASKRRKQYGEDGAEQTGEGSEVEDNKPLVP
KAGSADGEAETTSGGTGVDGESPDYDDIPVSKIPRGSNEDEKEAEAGDETVDSVPDSAGD
PASTPSRRDRKRSTARSRRNANSEEGGSARKNRGSLSAKALKKRRNRGRIVPESDGEDDT
LDRTPPPSPPPDSEMDSNKRRSSRNTQRKKYIDDVMLRFSDDENSLLVASPVKKDKKPSA
NASNSNAGSDVEKTEPQSGAEGDAAQEVGEEKSNLPLDESSQLEASSSTSAVAEKERQIS
TDAANAAMSSKPNYVYINTGDEDSMVVQLVLAMRMGKRELILDKPKEKAPEPKQDEEKSE
LDEATTDKPEGDEKFKTEGESKKDLTDSEETKLESSAMEVDSKEESEPDDSKKSDEDNKD
KDKMEVDDEVGKSDKESKPEEQSETVKTEENSKAIEEDKSSTVLTADHAKEPETVLEKME
VDEKANDDQSAVSKAEGSDEKSTDDSNPEEATTEKNKESLEIEGEKERVKEGEESVKKEN
DEKTEADMENKPEPVFIDVEEYFVKYRNFSYLHCEWRTEEELLKGDRRVAAKIRRFQQKQ
SQQLNIFENIEDEPFNQDFTEVDRVLDMSVHTDETSGETTKHYLVKWKSLPYEDCTWELE
EDVDNDKIEQYLRFNKIPQRSEWKSKKRPHPELWKKLEKTPVYKGGNSLRPYQLEGLNWL
KFSWYNTHNCILADEMGLGKTIQSLTFVHSVYEYGIRGPFLVIAPLSTIPNWQREFEGWT
DMNVVVYHGSVTSKQMIQDYEYYYKTESGKVLKEPIKFNVLITTFEMIVTDYMDLKAFNW
RLCVIDEAHRLKNRNCKLLEGLRQLNLEHRVLLSGTPLQNNISELFSLLNFLEPSQFSSQ
EEFMSEFGSLRTEEEVNKLQALLKPMMLRRLKDDVEKSLAPKEETIIEVELTNIQKKYYR
GILEQNFSFLKKGTTSANIPNLMNTMMELRKCCIHPYLLNGAEEQIQYDFKSQHGEDPES
YYKNLILSAGKMVLIDKLLPKLKANGHRVLIFSQMVRCLDILEDYLVYRKYPFERIDGRI
RGNLRQEAIDRYSKPGSDRFVFLLCTKAGGLGINLTAADTVIIYDSDWNPQNDLQAQARC
HRIGQRKMVKIYRLLCRNTYEREMFDKASMKLGLDKAVLQSMNTQGSKDGNNKQLSKKEI
EDLLKKGAYGAVMDDDNAGDKFCEEDIDSILKRRTQVITMESEKGSTFSKASFAASGNRS
DITIDDPDFWTKWAKKVDIDPDACERDETEDLVLSEPRRRTQIKRYGHEDVMELNSEESS
NENSDEEGGIGLRSRRRKEKRDRAREKKGNDEYIPRERDALAALGLEEIQYGNWAKSECF
KVEKGLLSFGWGRWSELLELGQFKRGWRDVDVEDCARIILLYCLQVYKGDEKIKTFIWDL
ITPTEDGEVQKISRDHSGLHNLVPRGRNGGKSNKESTGVSTPAPGSASGSNSGNTTPAHK
SSALDGSDKDSGGINASAVAAAVTSIHDPNHWSKKEKYDADAYLEGAYKKHLGRHANKVL
LRVRMLYYIQHEVIGDFVQQIKDNTPISELPIRPPPTPDQVPSSWWNPICCDKSLLVGTY
KHGCEMYRQMRADPNLCFVTHVGAGAAGDDLAVTSLPINEDDANSKHDDGDEVDDDGTTT
TKDSDSTKLTGGDNKDSLLDPERPSSSGKSSSENASGGNDKTESENDATTVSESSYKSEV
LPGKGSDLDVSVAQQDALSATPELANTSDPKMNKNDAQVSASVSCDPADSSSPEAAGKAQ
GTGVQTGDAGELDIESEKKDNEKETKESTGDAPAVEAKKDSAAIARAEGDKTESCTNNAT
TNISTTTTTTTITNTTTTTNNPSSKAANSNNTTDHANSNSHLGLDEEESVAGSYPPTVAA
VEDATTMWPSMQDLNTRLRRVITAYQRNYKKEELKLQQKAKLQALVSSTPPLSVPTTPTL
QSMQMQLQSGSGSGGSGIGSSAQHDASGRSLQALMQSQGASTSAAAAAAASSAGGSCSGS
GQVGMGGAGVMPAMPTAADISLMLSILNTTDVNQLANLDINKLAMYLVSMNNKMERQGKM
ELAAKERESQRLQLIPKKWNRREEYEFLRVLTGYGVDLHVSTPMASSNGSSLSPDWTKFK
QMAHLERKSDETLTDYYKVFVAMCKRQAGLKLSESERGLEGIIEEIEKEHAKLILDRLEV
LAKLREVARNPMLEERLKLCTKNADTPDWWEPGRHDKELITAVLKHGLYRSETFIFNDPN
FSFGESEKRFIRELEAQIQRTIKLEAFNAEKAEKLAAAEKDAATEKAAATEKAAAEKAAS
VKNEVIDLDDELMTNESVIKKESPVTPIKEEIKSEESPEKHDTADNLEDKNSDAEESTKI
KGKEDFNPETTEKEALDESTNLNKDKSSTETLVPEIEDSKPSEDKMEVEELPVAENGEKE
GSPEKCSDAEDKKFSEEKPSSPAVPDGKVSEMEADEAAPNTEENCSGDSESPEKECEDKV
VEKVEEEKGENSYEKAEEQKEETEKLEKSSIESEPSEKSETVLEPEVAVPKKSTGDQDIL
DLVAGPSDPDDDEVMKEKEKAVEEECKKQAAELKARFPDLEVIQPATVKQQKLEKPKLEM
CMIRWFKDFALERRIAHIVACVESGNWPVDSKYSAFATCKGATDLSIALHESIPHLSSLE
RRSTTPDVITITTDQGVTKHLQTSHMQQVASSASAASTSSGVPQVTQSKPSSSNSLPGLD
AKSINAAVAAAVAAAAAGGNATSLSSLLPGMSLSAATGSSAGGVSGLSVPSAGSGVGKKR
KRHIAIDVETERAKLHALLNSSTMAPKDWESEIANMEALSGSSGRGRGGNSSASSGMQPP
PAHQHASLSRQSSGQFSKPAVPAMKTPPPSMGAPMDLSSSLPKMNMTEMLKSASSSGAID
LSEVQDFSMPSKKSSVHAALSSAFPSMGNKSKLDDTLNKLMKKNNCTIEEPVIGKEKKRK
KLDEIVLGLSAAKEQKTFPDPSLPSSKKPQIPPSVSVTPANLQSSSNQQSNQKPFTITVT
TVPGKSKSGSSNSGSGTGGSSSASGGGAGGSGLSALQNMAMGGLSSKDSLNALLAQTMAT
DPQTFLKQQQKMMQFLPPAQRKAYENMLAEMEQAMKISSKFSTNSPHDVKVNKWLSDMTS
PLGDQLSIDYVGGGGASGSGSGNSRRSNRQQGNSQQSSSAAQLQKQQQQQQQQQQQQQQH
SMPGPQNLTGEEPVPVINKQTGKRLGGNKAPQLKRLMQWLTENPNYEVDPKWLEQMQNPM
STPSPRPASMESGYGSSAVKSHGGRPLSNLSSTSSSSHTQQQSSAAQSQAGGNSGSSKKN
SRQQTAASAALDQAALQFGSLAGLNPSLLANLPGLGAFDPKNPLAAFDPKNPLLSMSFGG
MPGMGNIPGLGNLNNMNLFASLAGMGGLGNLAGMDTQSLAALMAAAGPTLGGLTGASGGA
GSGKSQAQSQSSATSSSSSASKKKQQQQQQQAQNEAAQLAAAISASTGGSGASGGKNAAA
SASQLAAGFPFLFPNPSLLYPPMGLGGLNPYSLGSSGLGSAYDQLAQQYNLLNGATSSAS
NTSSTQSKSHQSQSKSSQSRNTTASANSAASLMNAMASMGGGASTVTTPSTSASGSGRGR
QSSSRNQSQTTPTAADMAQLSSLLMPGADPHLLESLSRMSNMDLAQATRLMSSLGMPPLS
GTPSSSGGGNTSTSKRSSQAANEANVQAKEQQKWLESLARGALPTDLAALQAFSQGKMPS
TSGSNTGTSTSSSKSSKAAATAAAAQLPQIPGMSSDFPQAFLAEMAAQAMAAAGGSLPLS
GPGSLASLAGLTGGSAGGGGSSASGSTSHSSSKRQREQDAFKQQMDYYTKTLGLGSGISL
IPTSSAGGSSASSSAANAAAAAYAAALDAEQQHQQQQKALSKRARGDLHPTKEELAALAA
GLPLNLGASMSSIEKSLRGGSSSSSSSTPAPMTAEQDKVTLTPLNASGGGSGSSSSSAAA
AGLAANLPSQTTITIAPPISSGASTSSERSERSESRISLTITNAADAAKLPPPYEEADEL
IIQPILKKPTAANPGSSHGGSVDDLDTAENTSAANLSGSSSSSAAAAAAAAAEENRRSSN
RLKRPRSGNEQGSGSVEGQPPEKRRELRSTRHTRSSADASTLNLSTGSESGAEERNE
Download sequence
Identical sequences B7Z002
7227.FBpp0289115 FBpp0289115 FBpp0077803 FBpp0289115 NP_001137761.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]