SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289193 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289193
Domain Number 1 Region: 370-557
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000235
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  FBpp0289193
Domain Number - Region: 1283-1404
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00262
Family FCH domain 0.083
Further Details:      
 
Domain Number - Region: 584-859
Classification Level Classification E-value
Superfamily Tropomyosin 0.015
Family Tropomyosin 0.002
Further Details:      
 
Domain Number - Region: 248-404
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0075
Further Details:      
 
Domain Number - Region: 820-1077
Classification Level Classification E-value
Superfamily Tropomyosin 0.0719
Family Tropomyosin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289193   Gene: FBgn0259246   Transcript: FBtr0299915
Sequence length 1740
Comment pep:known chromosome:BDGP5:2R:5391293:5427952:1 gene:FBgn0259246 transcript:FBtr0299915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSPYYRDMDEPTSPAGAGHHRSRSASRPPMAHAMDYPRTRYQSLDRGGLVDPHDREFIP
IREPRDRSRDRSLERGLYLEDELYGRSARQSPSAMGGYNTGMGPTSDRAYLGDLQHQNTD
LQRELGNLKRELELTNQKLGSSMHSIKTFWSPELKKERALRKEESAKYSLINDQLKLLST
ENQKQAMLVRQLEEELRLRMRQPNLEMQQQMEAIYAENDHLQREISILRETIKDLECRVE
TQKQTLIARDESIKKLLEMLQAKGMGKEEERQMFQQMQAMAQKQLDEFRLEIQRRDQEIL
AMAAKMKTLEEQHQDYQRHIAVLKESLCAKEEHYNMLQTDVEEMRARLEEKNRLIEKKTQ
GTLQTVQERNRLTSELTELKDHMDIKDRKISVLQRKIENLEDLLKEKDNQVDMARARLSA
MQAHHSSSEGALTSLEEAIGDKEKQMAQLRDQRDRAEHEKQEERDLHEREVADYKIKLRA
AESEVEKLQTRLERAVTERERLEIKLEASQSELGKSKAELEKATCEMGRSSADWESTKQR
IARLELENERLKHDLERSQNVQKLMFETGKISTTFGRTTMTTSQELDRAQERADKASAEL
RRTQAELRVTQSDAERAREEAAALQEKLEKSQGEVYRLKAKLENAQGEQESLRQELEKAQ
SGVSRIHADRDRAFSEVEKIKEEMERTQATLGKSQLQHEKLQNSLDKAQNEVDHLQDKLD
KACTENRRLVLEKEKLTYDYDNLQSQLDKALGQAARMQKERETLSLDTDRIREKLEKTQV
QLGRIQKERDQFSDELETLKERSESAQTLLMKAARDREAMQTDLEVLKERYEKSHAIQQK
LQMERDDAVTEVEILKEKLDKALYASQKLIDEKDTSNKEFEKMLEKYDRAQNEIYRLQSR
CDTAEADRARLEVEAERSGLAASKAREDLRKLQDESTRLQEACDRAALQLSRAKECEDNA
RSELEHSRDRFDKLQTDIRRAQGEKEHFQSELERVTYELERAHAAQTKASASVEAAKEEA
AHYAVELEKMRDRYEKSQVELRKLQDTDTFGRETRRLKEENERLREKLDKTLMELETIRG
KSQYESESFEKYKDKYEKIEMEVQNMESKLHETSLQLELSKGEVAKMLANQEKQRSELER
AHIEREKARDKHEKLLKEVDRLRLQQSSVSPGDPVRASTSSSSALSAGERQEIDRLRDRL
EKALQSRDATELEAGRLAKELEKAQMHLAKQQENTESTRIEFERMGAELGRLHDRLEKAE
AEREALRQANRSGGAGAAPHPQLEKHVQKLESDVKQLAMEREQLVLQLEKSQEILMNFQK
ELQNAEAELQKTREENRKLRNGHQVPPVAAPPAGPSPAEFQAMQKEIQTLQQKLQESERA
LQAAGPQQAQAAAAAGASREEIEQWRKVIEQEKSRADMADKAAQEMHKRIQLMDQHIKDQ
HAQMQKMQQQMQQQQQAAQQAVQQAAQQQQSAAGAGGADPKELEKVRGELQAACTERDRF
QQQLELLVTELEKSKMSNQEQAKQLQTAQQQVQQLQQQVQQLQQQMQQLQQAASAGAGAT
DVQRQQLEQQQKQLEEVRKQIDNQAKATEGERKIIDEQRKQIDAKRKDIEEKEKKMAEFD
VQLRKRKEQMDQLEKSLQTQGGGAAAAGELNKKLMDTQRQLEACVKELQNTKEEHKKAAT
ETERLLQLVQMSQEEQNAKEKTIMDLQQALKIAQAKVKQAQTQQQQQQDAGPAGFLKSFF
Download sequence
Identical sequences A1Z7V1
FBpp0289193 FBpp0289194 FBpp0289769 FBpp0289193 FBpp0289194 FBpp0289769 NP_001036535.1.81976 NP_724796.3.81976 NP_995785.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]