SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289271 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289271
Domain Number 1 Region: 92-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000848
Family CCCH zinc finger 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289271   Gene: FBgn0259728   Transcript: FBtr0299994
Sequence length 180
Comment pep:known chromosome:BDGP5:2R:5054071:5055023:-1 gene:FBgn0259728 transcript:FBtr0299994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVADYSDSSESDEDSSGQFSEDGETKSAAPAKNEKTPPPKLPSASQAFSQGAGKGDVF
NNPFLEAELHKTASLERHVKMVDNDAHQKLKNGRKICWNFRRGRCRFGTSCQYAHDSDLS
VDEAAEKSALPDQSVPVVVEAAPGNFNRRKRPGLGDALEPGKRVMKSYKQQNPQNPFARR
Download sequence
Identical sequences A1Z7R9
NP_523665.2.81976 FBpp0289271 FBpp0289271 FBpp0289271 7227.FBpp0289271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]