SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289278 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289278
Domain Number 1 Region: 8-281
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.28e-47
Family FCH domain 0.0093
Further Details:      
 
Domain Number 2 Region: 613-670
Classification Level Classification E-value
Superfamily SH3-domain 5.25e-20
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289278   Gene: FBgn0259734   Transcript: FBtr0300001
Sequence length 671
Comment pep:known chromosome:BDGP5:X:8933708:8947352:1 gene:FBgn0259734 transcript:FBtr0300001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNAQGQNGFEELRRYVKQGGDFSKELIFVLQERADSELIYSKSLSKLANKLNKAGREIP
GSVADAWRGVATEMESRSDIHRQLAASLTDELVKPLKIVVEGHHKARKAVESNVDKAARV
LGEWRASEAKAKKASHTAARENEKLQDAMLDVRIQKSPSIALLHQGPNKQAAEKELKSAE
KDCVKLDNKRKKAEEAVKRADVEYYTLCVRSERARVDWEMAVLRGSAQLQSSEQQRLGNM
HNFAQQYARLISDMNPILGGLSTRLQPQLDACNVAKDMQVVRHIRRNSEGPSEQLLPDFY
CEHTTLAMNRERRKHALIKLLQLVKTDLERERRSRDGLRGLSQSLNHQEHQNITDKLYHI
RSMLTYLEGARLKLHSALLELDHKPRATHPLAQHIHITRDRTGLQQSILKVPNWLKNNDK
SQTQQSTSMLAHDITDITTNHEDELPDENCSHLHSSSHSNNNSNGSCTDVSSVVKPFNRS
KSNIETNFTSQPKIISTTNAAIAVSVKSKTLANLQDGHHNNQQHHHHHHNHHSDRGQADG
GSNQQDSDFDEFSSQDEDDEPQQPQQQPQPLQSQQQQQQPLLQNPTINGQVQTQHFYQNA
QELQKGQKNGSVPILGRCKALYSYTPKLYDELELSPGDIIEVHAKQDDGWWLGALRNHIG
IFPATYVEECA
Download sequence
Identical sequences D5SHR1
FBpp0289278 FBpp0289278 NP_001162712.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]