SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289416 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289416
Domain Number 1 Region: 292-352
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-20
Family RING finger domain, C3HC4 0.0041
Further Details:      
 
Domain Number 2 Region: 117-174
Classification Level Classification E-value
Superfamily PA domain 0.0000000418
Family PA domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289416   Gene: FBgn0004919   Transcript: FBtr0300179
Sequence length 601
Comment pep:known chromosome:BDGP5:2R:20960179:20971843:-1 gene:FBgn0004919 transcript:FBtr0300179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIRKTLLLACLVLLFGGLPPLTFPATTTTLVAAMSIANQDLERYFRPGNGTHSFSGMED
RIAVDVYNYAFLNWSYVEHGNMLCNMEFAQEQARYGEGKVLNVTGRLIHITATDNFSDDY
ACTPYIRGTLGAPIPDKGETWIALVRRGRCTFEEKVKHVYQQNAAGVIIYNDKQVMQLEK
MQIKGKTRNIAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSVLFVSI
SFIVLMIISLVWLIFYYIQRFRYMQAKDQQSRNLCSVTKKAIMKIPTKTGKFSDEKDLDS
DCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYVFLGSEE
SILEYQPDPPQGLALVEARDESADLNRSRDFVVDFPRVFVLDSGCVVGAREMLFPCRIPE
RSQSSLSLRQARDWVSLMSNKLEEQQGLRSMRNDEMQQQLLSARESARHRRSRSADGRYS
TGCFGGRQRQPSVLVSSLGQPQLHSEVAQMQRSNSSQALKHLTDAAHAQSRQRQRESFDF
ARTRRRFMRRESDEISLRSLPRRGATSAAHRQLHREREPDDSVHTDQITIQVNGKGVDLN
Q
Download sequence
Identical sequences FBpp0289415 FBpp0289416 NP_001163300.1.81976 FBpp0289416 7227.FBpp0289416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]