SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289430 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289430
Domain Number 1 Region: 92-254,298-455
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 7.71e-80
Family NAD kinase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289430   Gene: FBgn0033853   Transcript: FBtr0300193
Sequence length 484
Comment pep:known chromosome:BDGP5:2R:9424893:9427030:-1 gene:FBgn0033853 transcript:FBtr0300193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHQKLRLASAMQRQISETEEQQVTPVAPDPRILRCTRNGKTSLRTRSLNAPSPFQHFGP
CGRIMKNSAMVMQIQDPASQRLTWYKPPLTVLVIKKKDSQVLPPFVQLVEWLVQEKHMVV
WVESAVLEDKLLRDDVKLEQESSKFQKVHQQYAGVRARFLDLREKLVTFKDGRDDLTDRI
DFIVCLGGDGTLLYASQLFQQSVPPVMAFYLGSLGFLTPFQCDNFQEQVTNVLEGHAALT
LRSRLRCSIHRKGERRKESLLHSVGGNLLIPSFQRQLNYVELNNGQTGKAGSNNNNGHNN
SILVLNEVVINRGPSPYLSNIDIFLEGKYITSVQGDGLIVSTPTGSTAYAAAAGASMIHP
SVPAILVTPICPHSLSFRPIVVPAGVELKISISPDSRNTSRVSFDGRNDQELNHGDSLRV
TTSIYPVPSICSQDQISDWFDSLAEGLHWNVRKRQKCLDELSDLTTSGSEDTLDDFDNLQ
IYDA
Download sequence
Identical sequences E1JH61
FBpp0289430 NP_001163146.1.81976 FBpp0289430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]