SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289593 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289593
Domain Number 1 Region: 154-439
Classification Level Classification E-value
Superfamily L domain-like 2.38e-50
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 464-761
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 5.13e-40
Family Rhodopsin-like 0.0027
Further Details:      
 
Domain Number 3 Region: 85-123
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000785
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289593   Gene: FBgn0085440   Transcript: FBtr0300364
Sequence length 806
Comment pep:known chromosome:BDGP5:X:13055747:13083197:-1 gene:FBgn0085440 transcript:FBtr0300364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIAHLPITFTLAILLAIASNEGAQGVESATRTAIEAIRTGIGTKPETEIADATEAEAPV
REVISLLGIIDGAESDILVPDADDKCPGGYFHCNTTAQCVPQRANCDGSVDCDDASDEVN
CVNEVDAKYWDHLYRKQPFGRHDNLRIGECLWPNENFSCPCRGDEILCRFQQLTDIPERL
PQHDLATLDLTGNNFETIHETFFSELPDVDSLVLKFCSIREIASHAFDRLADNPLRTLYM
DDNKLPHLPEHFFPEGNQLSILILARNHLHHLKRSDFLNLQKLQELDLRGNRIGNFEAEV
FARLPNLEVLYLNENHLKRLDPDRFPRTLLNLHTLSLAYNQIEDIAANTFPFPRLRYLFL
AGNRLSHIRDETFCNLSNLQGLHLNENRIEGFDLEAFACLKNLSSLLLTGNRFQTLDSRV
LKNLTSLDYIYFSWFHLCSAAMNVRVCDPHGDGISSKLHLLDNQILRGSVWVMASIAVVG
NLLVLLGRYFYKSRSNVEHSLYLRHLAASDFLMGIYLTLIACADISFRGEYIKYEETWRH
SGVCAFAGFLSTFSCQSSTLLLTLVTWDRLMSVTRPLKPRDTEKVRIVLRLLLLWGISFG
LAAAPLLPNPYFGSHFYGNNGVCLSLHIHDPYAKGWEYSALLFILVNTLSLIFILFSYIR
MLQAIRDSGGGMRSTHSGRENVVATRFAIIVTTDCACWLPIIVVKLAALSGCEISPDLYA
WLAVLVLPVNSALNPVLYTLTTAAFKQQLRRYCHTLPSCSLVNNETRSQTQTAYESGLSV
SLAHLGGGVGGGSGRKRMSHRQMSYL
Download sequence
Identical sequences Q0IGY0
FBpp0289593 NP_001096966.2.81976 7227.FBpp0289593 FBpp0289593 FBpp0289593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]