SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289616 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289616
Domain Number 1 Region: 19-99
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000848
Family RING finger domain, C3HC4 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289616   Gene: FBgn0008654   Transcript: FBtr0300387
Sequence length 1368
Comment pep:known chromosome:BDGP5:2R:8884006:8895307:1 gene:FBgn0008654 transcript:FBtr0300387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLQNTHNTMESNAAMDAASPASRDVRQFHDLITCRLCRGYMIDPTTVDYCYHTYCRSCI
LKHLLRAVYCPECKASGGKEINELNLKSDDTLRSLIYKLVPGLYQRECKELADFKEQHDL
VDEQTTDEPEFFTTTELISLSLEYHPAMLHQCGPGEVPPTIYLQCAAGLPVELLKRFLCS
KYNIETDNGLVEVEVTYKDEVLPTNFTLMDVAYCYNWSRESPMAFCYRILLYDNEQTKND
ENNLSRINQDIEPEHSVRRSKSAKSVTFAEDLESEIDSGSPRSKVRCKTPPKVSPSSKNK
RLTSSKREAEPESPVSNFKSLRSNDMRYSDYAVSKVKSEPEQEQFLLPREREQQPLEANT
NIVVSIPPSQLRKSYVDAEDFELKTANRKGVGHLPKLKIELNSMKSKLSMPLSAGPRLED
TSCSLSCSAQQLDLETYAKNIGLKPIEQPLQQSASNPDSKYSPNASPMSSCSSSTNGSSS
SLGTADASTSTSTSSSHRKRKKKHSKEPKDANGKRKKLHAEISSQTDGKMKVKITAKPNH
KLDFKRSHSLASGELDLQKLKLDSTSTSEALNRTLGEEARSINSLVVGGAPTPPPTPTAE
PEQQQQQQQQQQQPQQQQQQQQQQQQQQQFVVLPKIKDLTLPTSPPLPPSLFKAYTPSTT
PTAPHTVAGGKPKQQQQQMPQQPQAVLQQSLAKTNPAKPPLSSNNNRKPNSGHFAVPQAP
THRNMYHMQRYQSTPSSIASAANKMPKRSMSLDESHPAKQARLSQAQAMASSYAAKLHMQ
TSNQAKSQAAAFLPNPQMRSYGLPDLGSKPTLPMLCPASSSSQVTITPRPRATPSIYSFS
EPNIHVPALEIVRLPVNKQSAGGKGLTMPPLSPPATSSARLMGPPAALPKHAGHGHGAAK
RSCQMPTMPMPLPLPLPMPMTTIPAIVKSPPLSVALSGQRNNKGNSSNSNAYRTSPPALI
NLRNTAAPQHSFPSKSSPKVEANSKKSPPAAGCQGKTNGTAALDKSKTSLREFRPAVQSA
VTATATTSVTTAAGAGAGAGTGTGTALAKDADILDLSANPGRSNNDAKLAPNSPPAGNNN
NNNNNNNNNNNNNNNNNNNSTSNSLEAALNKIKQNISANSNGGPSTTSGSNSNGTTNGDD
LQNLHMLSESATAREKISIKAASSGNGSGSTSSSSAKPKNANALVRPQNASVRSIPNPSA
LAFRNQPAAASTAASISKPLTVRAEEKPKVSTSNPGSLSPTNTSSSSSSSSSGSSGCSAA
TSPRAMTKKPTTIDQVAANLNIRAEAKAAALAEEAPPVLSSNAAKSPELAKTTTAVALRP
EPKETPITVSAASTLLTIPSAVSSVSAVPETMAKPPVQIANAPVASSA
Download sequence
Identical sequences E1JH51 P25172
FBpp0086906 FBpp0289616 FBpp0086906 NP_001163134.1.81976 NP_523726.2.81976 FBpp0086906 FBpp0289616 7227.FBpp0289616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]