SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289842 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289842
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000583
Family V set domains (antibody variable domain-like) 0.057
Further Details:      
 
Weak hits

Sequence:  FBpp0289842
Domain Number - Region: 144-193
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0334
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289842   Gene: FBgn0028645   Transcript: FBtr0300615
Sequence length 327
Comment pep:known chromosome:BDGP5:2L:15905134:15962432:-1 gene:FBgn0028645 transcript:FBtr0300615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKPALKLRRLFIITAIYIASLPGLTVGLRNVNVRIPSAVKRGDNALLICNYDIENDTLY
TVKWYRGRREFYRYTPKENPAWKIFTKTNEIDVETAQSNASHVLLRNVPTSISGKFACEV
SADAPTFDTSIVAADMEVVELPTQRPIITGIHSRYRLGDVINGNCSSDYSKPAANLTWWI
NDIQVPPNYLRIYDIQRHVAEHLESAVLEIKFVVTVHHFIKSRLKLKCSARIHEIYAQES
EKLIEEDRPRILASGRSPDMNMYPFDQPGDADEHNELFLIHSNAACGPFAWHPILFLLLW
PSFWVFAAWENWLWNLLEARLFGRAVR
Download sequence
Identical sequences Q9VJM9
7227.FBpp0080366 FBpp0080366 FBpp0080366 FBpp0289842 NP_001162987.1.81976 NP_523579.1.81976 FBpp0080366 FBpp0289842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]