SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0289929 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289929
Domain Number 1 Region: 609-659
Classification Level Classification E-value
Superfamily RING/U-box 2.16e-19
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289929   Gene: FBgn0039150   Transcript: FBtr0300705
Sequence length 669
Comment pep:known chromosome:BDGP5:3R:19935666:19938124:-1 gene:FBgn0039150 transcript:FBtr0300705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNSPKDPYRGGGGGSGPQDGAGSTGVSINIESDDNDSTTAEHDYLLPASSSSVTSGGGV
GGGGVVSGGSTSTSVNLDHQHVPTARSSSLSGGNVRHGNILSTFLARQRSYTPASNSSSP
VRVTTQMNRRLQQSRSMGANTGGSLEEPSSAGAAGGPGASPGTAAGVRQMGFWRVNLNDV
FSLSTASSTEALRSFISHSNFRYPPATTAAPAAPGPQPAANPVDNSHILLGQQQPSMPEP
VSPLRYGRVSAVSGASSAGAMGRSISLREGEMRHNHSLNGGRHNASAIGLNSNPAAFDER
EANESQDLDESDGNVENGGGGGNPPEPAENNPEDEHLISDDMVVQILSHFVRYLPLIFIL
FFKFLHDHLLGIVDLLVLQTVMYNVNRSVRNQVARLAQKNYAVMVRDTFLVAVVVTVRLF
LATSPPDPFGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDTYKSLNVI
PLGMLLYYIAVSDLIIKLLTMLVKLIITMLPHHLMRLKVRARLYVLVEYISQFYRAMTPI
TQWLLFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSLKKAIVTFRKNIDSERPPTK
DELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCPMCRAKVSDDPAWQDG
STTFFHQLY
Download sequence
Identical sequences Q9VCD3
FBpp0289929 NP_651214.2.81976 FBpp0289929 FBpp0289929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]