SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290102 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0290102
Domain Number - Region: 259-279
Classification Level Classification E-value
Superfamily RING/U-box 0.0015
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290102   Gene: FBgn0029911   Transcript: FBtr0300880
Sequence length 285
Comment pep:known chromosome:BDGP5:X:6733455:6737953:-1 gene:FBgn0029911 transcript:FBtr0300880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKASTPATSGQQSPRSRTFSSSSTGAADSALQQQQHQHSNPGQNRGGNGGGGGGNDTT
GQGFNLLRTLPGLQVYHNQNSTSIDRQRARSLSSVPDIQQQAQQQQQQGSITSSGSSPHS
HPHAAHGHPAVGVTVSVSGNANANSNSNFTAAGNNNGSAMQSYMQQRRTLGDSIRDMSMT
GGSIAESIALAASATSANGIGRVYTATSLPSHIWSFNGIKCPVCNKFVLPDDIECHLVMC
LTKPRLSYNEDVLSDAKGECVICLEDLSPGDTIARLPCLCIYHKG
Download sequence
Identical sequences Q3KN54
FBpp0290102 FBpp0290102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]