SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290118 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290118
Domain Number 1 Region: 62-225,286-431
Classification Level Classification E-value
Superfamily L domain-like 4.27e-41
Family Ngr ectodomain-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290118   Gene: FBgn0037553   Transcript: FBtr0300896
Sequence length 559
Comment pep:known chromosome:BDGP5:3R:4045863:4047910:1 gene:FBgn0037553 transcript:FBtr0300896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFYKYILLGICGLTVSDALAVYDASGRFNLSASCPDSFCSLSDRPVAYSATPALQLREL
HLRNCSRQSITWLVLQLTPGLRTLVIRNCATYHISKESLRPVENLTSLQMQGTSLGVLRD
QIFNAVPRLEILQLSQNFIHTVHVAAFQGLSKLRLLGLQGNAIAEILSSTLDPLMELVHL
DLSRNELTTLPQNIFAKNKKLQTLLLNGNPLRILMPDVLGSLPNLRLLDLGHAAELEVMT
LNLTNVQNLVLEGSSLSSLVINGGFIKLQAGNNELNHLQVGNKSSVIEMDLHGNLLNGND
TAALLRGMWNLQRLDLSKNRIEALPQHGSGLDASGTQELLILPSLKFLNLANNQLVRLPP
ESPILSSRLSYLDLSHNLMLTLDVAILRSLSVLKGLYVEGNRLNTINYQKLHEEHPDLSE
LGLHDNPWSSGLYRKMFLYFTDRGVHLQARPQNRVLNKSSRVDIDWPPNEGQAEAQKMDP
PGVTGIHPYWTLRDILAFVTLLVVMIILLMNLYHILEEEGCLRRFRHWRRSRTLGQNTST
TRNSGRRLDEQDSEQSSSE
Download sequence
Identical sequences E1JJ89
NP_001163549.1.81976 FBpp0290118 FBpp0291388 FBpp0290118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]