SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0290176 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0290176
Domain Number 1 Region: 32-271,308-334
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.44e-61
Family BAR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 546-704
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-51
Family Ankyrin repeat 0.0000427
Further Details:      
 
Domain Number 3 Region: 427-542
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.71e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0000562
Further Details:      
 
Domain Number 4 Region: 309-413
Classification Level Classification E-value
Superfamily PH domain-like 3.21e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 5 Region: 1065-1126
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0290176   Gene: FBgn0050372   Transcript: FBtr0300954
Sequence length 1127
Comment pep:known chromosome:BDGP5:2R:4001791:4010356:-1 gene:FBgn0050372 transcript:FBtr0300954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPSLIAVSEFVEETRSDYSSPTTSTFASRMPDCRHTIGVLEERLEFDREGLTKLKKAVK
AIHNSGNTHVDNEMFMVRALERLGGKVIEQDEPDIGAAFLKFSVVTKELSALMKTLMQNI
NNIVMFPVDSMLKSELRGVKGDMKRPFDKAAKDYEAKFIKIEKEKKAQAKEAGMVRTEID
AAVVAEEMEKERRLYQLQTCEYLLKYKDIKTKTGIELLQHLIEYYHALSNYFKDGLQTIE
HFGTYIGDLSEKLHEIKQKQDEDRRSLLDLRTVLRSTPDFERVDNVPSSESRSGGAGYSL
HQLQGDKHHGVTRQGHLLKKSEGKVRRVWQKRRCRVTSDGFLDIFHADESKPPTRVNLLT
CQIKPVPDDKRGFDLISYNRPYHFQAEDEGDQKAWMAVLVNCKEKALTKAFQHANPQMSP
SLVELQKTVIRYVQLLPGNDRCCDCGSRNDVTWISLNFGILVCIQCSGVHRDLGVHHSRI
QSLTLDNLTTANLLIARAMGNSTLNDIMEAKLGRGKLQHESSMEERYDFIRAKYVAKRYV
MRTCSDDNDLRCDLEQAVVNADMSQLLQVWAEGADLTCCLPSSDAGETALHLAVLREMGS
TLHIVDFLIQNMPPKGLNKATNPAGLLDVTGKNTALHLCALHDRRECMKLLLRSGADYEL
KNSQNKTALDIAKEMGHNSCRELIECAIKREKSAFDHINTDWNLPNEDGSTDFSDDETVI
DERSSSSPIANCPSRQFTLPSGLPSYTHSAGTSPKQHISVGQYLGSATNVGGNGPGNGGS
SPSSASSQSVRAARNSLNMQSDLGGHVTGARKSTSTANMNSLKKRTAPAPPPGTLGSASS
SSFYGTLPHPPRHSQNFDASDIRAINHKNQSLDVAYGTLPHLRSVESSPRGGGGYGYGVS
QDPGGSGNGSNNSLMPAMTTFGHKRSPSGESLNRNIHLAGAKLVLPPTGELPTLKHVDKS
ALTRPKIPPPGPPSEREISNGQSNESISSMDEGPVAPPRKLVNQSANFPDYESWHTDMDS
SGGGLDHSAESNVSSSDNDRLNSSPDNPSKTGGAGLGGKFHYNGQRRCRALYDCVADNDD
ELEFKEGEILIVLNERTDDENWMEGIIEGQPTRKGMFPVSFVHMLPD
Download sequence
Identical sequences FBpp0290176 FBpp0290176 NP_001163085.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]